KEGG   Streptomyces griseus: SGR_2604Help
Entry
SGR_2604          CDS       T00691                                 

Definition
(GenBank) putative glutamate dehydrogenase
  KO
K00262  glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
sgr  Streptomyces griseus
Pathway
sgr00220  Arginine biosynthesis
sgr00250  Alanine, aspartate and glutamate metabolism
sgr00910  Nitrogen metabolism
sgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SGR_2604
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SGR_2604
   00220 Arginine biosynthesis
    SGR_2604
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     SGR_2604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N Mur_ligase 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: BAG19433
Kitasato: SGR2604
UniProt: B1W2R9
Position
complement(3084310..3085698)
Genome map
AA seq 462 aa AA seqDB search
MPVIPDSPDSTRTHDAADRVIEPLYAEILRRNQGEQEFHQAVREVLETLGPVLIRRPEFI
DARIIERICEPERQLIFRVPWSDDSGDIHVNRGFRVEFSSSLGPYKGGLRFHPSVNLGIV
KFLGFEQIFKNALTGMPIGGGKGGSDFDPKGRSDAEIMRFCQSFMTELHRHLGEYTDVPA
GDIGVGGREIGYLFGQYKRITNRYESGVLTGKGLGWGGAQARTEATGYGTVLFTAEMLRS
RGESLDGQTVAVSGSGNVAIYAVEKAQQLGATVVTCSDSSGYVVDEKGIDLALLKEIKEA
GRGRVSEYAERRGAHARFVPGTGVWSVPVDVALPCATQNELHEADALALVRNGVKAVAEG
ANMPTTPEAVRVFQEAGVAFAPGKAANAGGVATSALEMQQNASRDSWTFSHTEERLAEIM
RHIHDSCYTTAERYGSPGNYVVGANIAGFELVADAMLAQGLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcatccccgactcgcccgactccacccgcacgcacgatgccgcggaccgcgtc
atcgagccgctctacgccgagatcctgcgccgcaaccagggtgagcaggagttccaccag
gcggtccgcgaggtcctggagacgctcgggccggtgctgatccgacgccccgagttcatc
gacgcgcggatcatcgagcgcatatgcgagcccgagcgccagctgatcttccgggtgccg
tggtcggacgactccggcgacatccacgtcaaccgcggtttccgggtggagttctccagc
tcgctcggcccctacaagggcgggctgcgtttccacccctcggtcaacctcggcatcgtg
aagttcctgggcttcgagcagatcttcaagaacgccctcaccggcatgcctatcggcggc
ggcaagggcggctcggacttcgaccccaaggggcggtccgacgccgagatcatgcggttc
tgccagtccttcatgaccgaactccaccgtcatctcggggagtacaccgacgttccggcc
ggtgacatcggcgtgggcggccgggagatcggctacctcttcggccagtacaagcggatc
accaaccgctacgagtccggcgtcctcaccggcaagggcctcggctggggcggcgcgcag
gcccgtacggaggccaccggctacggcacggtcctgttcaccgccgagatgctgcgcagc
cggggcgagtcgctggacggccagaccgtcgccgtctccggttccggcaacgtggccatc
tacgcggtggagaaggcccagcagctcggcgcgaccgtggtgacctgctcggactccagc
ggctacgtcgtcgacgagaagggcatcgacctggccctcctcaaggagatcaaggaggcg
ggccggggccgggtctcggagtacgcggaacggcgcggcgcgcacgcccggttcgttccc
ggtacgggggtgtggtcggtccccgtggacgtggccctgccctgtgccacgcagaacgaa
ctccacgaggcggacgcgctggccctcgtgcgcaacggggtcaaggcggtcgcggagggc
gccaacatgcccaccaccccggaggcggtccgggtgttccaggaggcgggcgtcgccttc
gcccccggcaaggcggccaacgcgggcggggtcgcgacgagcgcgctggagatgcagcag
aacgcgtcccgggactcgtggaccttctcccacacggaggagcggctcgccgagatcatg
cggcacatccacgactcctgctacacgaccgccgagcggtacggcagccccggcaactac
gtggtgggcgcgaacatcgcgggcttcgagctggtcgcggacgcgatgctggcccagggt
ctgatctga

DBGET integrated database retrieval system