KEGG   Streptomyces griseus: SGR_2608Help
Entry
SGR_2608          CDS       T00691                                 

Definition
(GenBank) putative lipoprotein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkuD
Motif
Other DBs
NCBI-ProteinID: BAG19437
Kitasato: SGR2608
UniProt: B1W2S3
Position
complement(3089427..3090680)
Genome map
AA seq 417 aa AA seqDB search
MTDSKRRKGLMAVSALLGGVLVLSACTDDGDKGGKANTGTSESSQQDVDKAAAADASEAQ
IAIKPKNGATNASINNAAQVTVAKGKLTKVVMTTADGTPVEGTLAADGSSWKPADQLERS
TTYKIDATAADSKGREAHENSSFTTVSPDNSFIGNFTPEDGSTVGVGMPVSINFNKAITD
KKAVQAGITVTSSSGQEVVGHWFNSQRLDLRPESYWQGGSTVTLKLALDGVEGADGVFGV
QQKTVTFKVGRNQVSTVDVKSKTMTVARDGKTIKTIPISAGSPENPTYNGQMVISEKHKE
TRMNGATVGFTDDDGKGEYDIKDVPHAMRLSTSGTFIHGNYWGKGIFGNANTSHGCVGLA
DVKGANDSSAPGAWFYDNSLVGDVVIVKNSPDKTITPDNGLNGWNMSWAEWTAGSQA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgacggacagcaagcggcgcaagggcctcatggccgtgtccgcactgctcggcggcgtg
ctggtgctttcggcctgtaccgacgacggcgacaagggtggcaaggcgaacaccggcacc
tcggagtcgtcgcagcaggacgtcgacaaggcggcggccgcggacgcctccgaggcgcag
atagcgatcaagccgaagaacggcgcgaccaacgccagcatcaacaacgctgcccaggtc
accgtcgccaagggcaagctgaccaaggtcgtcatgaccaccgcggacggcaccccggtc
gagggcacgctggcggccgacggctccagctggaagcccgcggaccagctggagcggtcc
accacgtacaagatcgacgccacggcggccgactcgaagggccgcgaggcccacgagaac
agctccttcaccaccgtctcgcccgacaacagcttcatcgggaacttcacccccgaggac
ggctccaccgtcggtgtcgggatgcccgtctcgatcaacttcaacaaggcgatcacggac
aagaaggccgtccaggccggcatcaccgtgacctccagcagcggccaggaagtcgtcggc
cactggttcaactcccagcgcctggacctgcgcccggagagctactggcagggcggctcc
accgtcaccctgaagctggccctcgacggcgtcgagggagcggacggcgtcttcggcgtc
cagcagaagaccgtgaccttcaaggtcggccgcaaccaggtctccaccgtcgacgtgaag
tccaagaccatgaccgtcgcccgcgacggcaagacgatcaagaccatcccgatctccgcg
ggctcgccggagaaccccacgtacaacggtcagatggtgatctccgagaagcacaaggag
acccggatgaacggcgccaccgtcggcttcaccgatgacgacggcaagggcgagtacgac
atcaaggacgtgccgcacgccatgcgcctgtccacgtcgggcaccttcatccacggcaac
tactggggcaagggcatcttcggcaacgccaacaccagccacggctgcgtgggcctcgcc
gacgtgaagggcgcgaacgactccagcgcacccggcgcctggttctacgacaactccctc
gtcggcgacgtggtcatcgtcaagaactccccggacaagaccatcaccccggacaacggc
ctcaacggctggaacatgagctgggccgagtggacggccggctcccaggcctga

DBGET integrated database retrieval system