KEGG   Streptomyces griseus: SGR_2614Help
Entry
SGR_2614          CDS       T00691                                 

Gene name
cyaA
Definition
(GenBank) adenylate cyclase
  KO
K01768  
adenylate cyclase [EC:4.6.1.1]
Organism
sgr  Streptomyces griseus
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SGR_2614 (cyaA)
Enzymes [BR:sgr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     SGR_2614 (cyaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3095771..3096970)
Genome map
AA seq 399 aa AA seqDB search
MTVGDTTSGSGEEPAADSSVHATPHHEVDHTVEPTDDPLAIRLEALILGADRRYTPFQAA
RTAGVSMDLASRFWRAMGFADIGQAKALTEADVLALRRLAGLVEAGLLSEPMAIQVARST
GQTTARLAEWQIDSFLEGLTEPPEPGMTRTEVTYPLVELLLPELQEFLVYVWRRQLAAAT
GRVVQAADDEEMVDRRLAVGFADLVGFTRLTRRLEEEELGELVESFETTAADLVAAHGGR
LIKTLGDEVLFAADDAGTAAEIALRLIEAMSQDETMPALRVGIAFGTVTTRMGDVFGTTV
NLASRLTSIAPKDAVLVDGAFAKELVRHGEAPESEAQAAEAVAAAAERVRLAEKEGREPD
DEPPLPTYRFGLQPMWQRPVRGLGVVEPWLLARRGKTGS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcggcgacacgacgtccggctcgggtgaggagcccgcggcggactcctcggtc
cacgccacaccccaccacgaggtcgaccacacggtggagccgaccgacgaccccctcgcc
atccgcctcgaagcgctgatcctgggggcggaccggcgctacacgcccttccaggcggcc
cgcaccgccggggtctccatggacctggcctcccggttctggcgggccatgggcttcgcc
gacatcggccaggccaaggcgctgaccgaggccgacgtcctcgccctgcggcggctcgcc
ggtctggtggaagcggggctgctcagcgagccgatggcgatccaggtcgcccgctccacc
gggcagaccaccgcccggctggccgagtggcagatcgactcgttcctggaggggctgacc
gagccgcccgagcccggcatgacccgcaccgaggtcacgtatccgctggtcgagctgttg
ctcccggagctccaggagttcctcgtctacgtgtggcggcgccagctcgccgccgccacc
ggccgggtggtgcaggcggcggacgacgaggagatggtcgaccggcggctcgccgtcggc
ttcgccgacctggtcggcttcacccggctgacccggcgcctggaggaggaggagctcggc
gagctggtcgagtccttcgagacgaccgccgctgacctggtcgccgcccacggcggccgg
ctcatcaagaccctcggcgacgaggtcctcttcgccgccgacgacgcgggcaccgcggcc
gagatagcgctccggctgatcgaggccatgtcccaggacgagacgatgcccgccctgcgc
gtcggcatcgccttcggcacggtcaccacccgcatgggcgatgtcttcggcaccacggtg
aacctcgccagccggctcacctcgatagctccgaaggacgccgtcctggtcgacggggcg
ttcgccaaggagctggtccggcacggtgaggccccggagtccgaggcgcaggccgccgag
gcggtcgccgccgccgccgaacgggtccggctcgccgagaaggagggccgcgagcccgac
gacgagccgccgctgccgacgtaccgcttcgggctccagccgatgtggcagcgcccggtg
cgcgggctcggcgtggtggagccctggctgctggcccggcgggggaagaccggctcctga

DBGET integrated database retrieval system