KEGG   Streptomyces griseus: SGR_2622Help
Entry
SGR_2622          CDS       T00691                                 

Definition
(GenBank) putative TetR-family transcriptional regulator
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3103616..3104194
Genome map
AA seq 192 aa AA seqDB search
METSTARPPVRPMRADARRNHDRLVGEARRSFAEHGTDASLEDIARRAGVGIGTLYRHFP
NRDALMNAVFQDALSSLLDRSRELAAAEAPCRALVDWLGAIVTHAGEYRGLAHGLMSASR
DGTSALVQCHLPLREAGAGLLRRAQESGSVRADVSIDDLLQLTNAIALAAEQSPDDPELA
ERLLRLTLRGLK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggagacgagcacggcacgaccaccggtccggccgatgcgcgcggacgcgcgccggaac
cacgaccggctggtgggcgaggcccgcaggtccttcgccgagcacggcacggacgcgtcg
ctggaggacatcgcccgccgggcgggagtgggcatcggcaccctctaccggcacttcccg
aaccgggacgccctgatgaacgcggtcttccaggacgccctgagctcactcctggaccgc
tcccgggagctggcggcggcggaggccccgtgccgggcgctggtcgactggctgggcgcg
atcgtcactcatgcgggtgagtaccgcggcctggcccacggcctgatgtccgcctcgcgc
gacgggacctccgcgctcgtccagtgccatctgccgctccgggaggcgggcgcggggctg
ctgcgccgggcccaggagagcgggtcggtgcgggcggacgtctcgatcgacgacctgctc
cagctcaccaacgcgatcgcgctggcggccgagcagtcgcccgacgacccggagttggcg
gagcgcctgctgcggctgacgctgcgcgggctgaagtag

DBGET integrated database retrieval system