KEGG   Streptomyces griseus: SGR_2624Help
Entry
SGR_2624          CDS       T00691                                 

Definition
(GenBank) putative oxidoreductase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sgr  Streptomyces griseus
Pathway
sgr00010  Glycolysis / Gluconeogenesis
sgr00020  Citrate cycle (TCA cycle)
sgr00260  Glycine, serine and threonine metabolism
sgr00280  Valine, leucine and isoleucine degradation
sgr00620  Pyruvate metabolism
sgr00630  Glyoxylate and dicarboxylate metabolism
sgr00640  Propanoate metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01130  Biosynthesis of antibiotics
sgr01200  Carbon metabolism
Module
sgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sgr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_2624
   00020 Citrate cycle (TCA cycle)
    SGR_2624
   00620 Pyruvate metabolism
    SGR_2624
   00630 Glyoxylate and dicarboxylate metabolism
    SGR_2624
   00640 Propanoate metabolism
    SGR_2624
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGR_2624
   00280 Valine, leucine and isoleucine degradation
    SGR_2624
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SGR_2624
Exosome [BR:sgr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SGR_2624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA K_oxygenase XdhC_C FAD_binding_2 AlaDh_PNT_C FAD_oxidored NAD_binding_8 DFP HTH_24
Motif
Other DBs
NCBI-ProteinID: BAG19453
Kitasato: SGR2624
UniProt: B1W2T9
Position
complement(3105383..3106810)
Genome map
AA seq 475 aa AA seqDB search
MIIGGGPGGYEAALVGAQLGAEVTVVDCDGLGGASVLTDCVPSKTLIATAEVMTTFDSSY
EELGIIVADDTPHVEQAARVVGVDLGKVNRRVKRLALAQSHDITASVTRAGARVMRGRGR
LDGLQAADGSRQVVVTAADGTEERLTADAVLIATGGHPREIPDAQPDGERILNWTQVYDL
DELPEELIVVGSGVTGAEFAGAYQALGSRVTLVSSRDRVLPGEDPDAAAVLEDVFRRRGM
NVMARSRAQSAKRVGDRVEVTLADGRVITGSHCLMAVGAIPNTAGMGLEEAGVRLKDSGH
VLTDRVSRTSAPGVYAAGDVTGIFALASVAAMQGRIAMYHFLGDAVAPLNLKAVSANVFT
DPEIATVGYSQADVDAGRIEARVVKLPLLRNPRAKMQGIRDGFVKIFCRPGTGIVVGGCV
VAPRASELIHPISIAVDNNLTVEQIANAFTVYPSLSGSIAEVARQLHTRKLTGEG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatcggcggcggccccggcggctacgaggcagccctggtgggcgcccagctcggc
gcggaggtgaccgtcgtcgactgcgacggtctgggcggggcctcggtcctcaccgactgc
gtgccctcgaagaccctgatcgccacggccgaggtgatgaccaccttcgactcctcgtac
gaggagctgggcatcatcgtcgccgacgacaccccgcacgtggagcaggccgcccgggtt
gtcggcgtggacctcggcaaggtcaaccggcgggtcaagcgcctcgcgctcgcccagtcc
cacgacatcaccgcctccgtcacccgggccggcgcccgcgtgatgcgcggccggggccgg
ctcgacgggctccaggccgccgacggctcccgccaggtcgtcgtcaccgccgccgacggc
accgaggagcggctgaccgccgacgccgtgctgatagcgaccggcggccacccccgggag
atccccgacgcgcagcccgacggcgagcgcatcctgaactggacccaggtctacgacctc
gacgagcttcccgaggagctcatcgtcgtcggatccggcgtcaccggcgccgagttcgcc
ggggcctaccaggcgctcggctcgcgcgtcacgctcgtctcctcccgcgaccgggtgctg
cccggcgaggacccggacgccgccgccgtcctggaggacgtcttccgccgccgcgggatg
aacgtcatggcccgctcccgcgcccagtccgccaagcgcgtcggcgaccgggtcgaggtg
acgctggccgacggccgggtcatcaccggctcgcactgtctgatggcggtcggcgcgatc
ccgaacaccgcgggcatgggcctggaggaggccggcgtacggctcaaggactccgggcac
gtcctcaccgaccgggtctcgcgcaccagcgcccccggcgtctacgcggccggtgacgtc
accgggatcttcgcgctcgcctcggtcgccgcgatgcagggccgtatcgcgatgtaccac
ttcctcggcgacgcggtcgcgccgctgaacctcaaggccgtctccgccaacgtcttcacc
gacccggagatcgccaccgtcggctacagccaggccgacgtcgacgcgggcaggatcgag
gcccgggtcgtcaagctgccgctgctgcgcaacccgcgggccaagatgcagggcatccgc
gacgggttcgtcaagatcttctgccgccccggtacggggatcgtggtcggcggctgcgtg
gtcgcgccgcgcgccagcgagctgatccaccccatctcgatcgcggtcgacaacaacctg
acggtggaacagatcgcaaacgcattcaccgtgtacccgtccctgtccggatcgatcgcc
gaagtggcccggcagctgcacacccgcaagctcacgggcgagggctga

DBGET integrated database retrieval system