KEGG   Streptomyces griseus: SGR_2627Help
Entry
SGR_2627          CDS       T00691                                 

Definition
(GenBank) putative phosphomannomutase
  KO
K01840  
phosphomannomutase [EC:5.4.2.8]
Organism
sgr  Streptomyces griseus
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SGR_2627
   00520 Amino sugar and nucleotide sugar metabolism
    SGR_2627
Enzymes [BR:sgr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     SGR_2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3108715..3110358
Genome map
AA seq 547 aa AA seqDB search
MQHDLIAQAHTWLAEDPDPETRAELGAIVEAGDTQELAARFAGTLQFGTAGLRGELGAGP
MRMNRSVVIRAAAGLAAYLKAQGQEGGLVVIGYDARYKSAEFARDTAAVMTGAGLRAAVL
PRPLPTPVLAYAIRHLGAVAGVEVTASHNPPRDNGYKVYLGDGSQIVPPADGEIAAAIDA
VGPLAGVVRPEDGWETLGDEVLAAYLARTDAVLAPDSPRTARTVYTALHGVGTSVLTAAF
ARAGFPEPVLVAEQAEPDPAFPTVAFPNPEEPGAMDLAFATARRAAPDLIIANDPDADRC
AVAVPDSSVEGGWRMLRGDEVGALLAAHLVERGATGVFAESIVSSSLLGRIAEKAGLGYE
ETLTGFKWIARVDGLRYGYEEALGYCVDPEGVRDKDGITAALLVAELASVLKEQGGRTLL
DLLDDLALAHGLHATDQLSVRVEDLSVIADAMTRLRERPPTALAGLAVTSAEDLSQGTDR
LPPTDGLRYRLEGARVIVRPSGTEPKLKCYLEVVVPVADAAGLPAARARGAELLAGIKRD
LATAAGI
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcacgacctcatcgcgcaggcccatacctggctggccgaggatcccgaccccgag
acgcgcgcggagctgggcgcgatcgtcgaggcgggcgacacccaggaactcgccgcccgc
ttcgcgggcacgctccagttcggcaccgccggcctgcgcggggagctcggggccgggccg
atgcggatgaaccggtccgtggtgatccgggcggcggcggggctcgccgcctacctgaag
gcccaggggcaggagggcgggctcgtcgtcatcggctacgacgcccgctacaagtcggcg
gagttcgcgcgcgacacggcggcggtgatgacgggcgccggactgcgtgccgccgtgctc
ccccgcccgctccccacccccgtactggcgtacgccataaggcacctgggcgccgtcgcc
ggcgtcgaggtcaccgccagccacaacccgccccgcgacaacggctacaaggtctacctc
ggcgacggctcccagatcgtgcccccggcggacggcgagatcgcggccgccatcgacgcg
gtcggcccgctggcgggcgtcgtacgccccgaggacggctgggagaccctcggcgacgag
gtcctggccgcctacctcgcccgtacggacgcggtcctggcccccgacagcccccgtacc
gcgcgcacggtctacacggccctgcacggcgtcggcacctccgtgctgaccgccgcgttc
gcccgggccggtttcccggagccggtcctcgtcgccgagcaggcggagcccgaccccgcg
ttccccaccgtggccttccccaacccggaggagcccggcgcgatggatctcgccttcgcc
accgcacgccgggcggcaccggacctgatcatcgccaacgacccggacgcggaccgctgc
gccgtggccgtgcccgacagctccgtcgagggcggctggcggatgctgcgcggcgacgag
gtgggcgcgctgctcgccgcgcacctggtggagcggggcgcgacgggggtcttcgccgag
tcgatcgtctcgtcgtcgctgctgggccggatcgcggagaaggcgggcctgggctacgag
gagacgctgacgggcttcaagtggatcgcccgggtggacggcctgcggtacggctacgag
gaggcgctcggctactgcgtcgaccccgagggcgtccgcgacaaggacggcatcaccgcc
gccctgctcgtcgccgagctcgcctccgtactcaaggagcaggggggccgtacgctcctg
gacctgctggacgacctggcgctcgcgcacggcctgcacgccaccgaccagctctcggtg
cgggtggaggacctctccgtcatcgcggacgccatgacccggctccgcgagcggccgccg
accgccctggccggtctcgcggtcacctcggccgaggacctgtcgcagggcacggaccgg
ctgccgcccaccgacgggctgcgctaccggctggagggggcccgggtgatcgtccgcccg
agcggcaccgagccgaagctgaagtgctacctggaggtcgtcgtcccggtggcggacgcg
gccgggctgcccgcagcgcgggcccggggcgccgaactgctcgccgggatcaagcgggac
ctggcgacggccgcgggcatctga

DBGET integrated database retrieval system