KEGG   Streptomyces griseus: SGR_2631Help
Entry
SGR_2631          CDS       T00691                                 

Definition
(GenBank) putative aldehyde dehydrogenase
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Bac_DNA_binding
Motif
Other DBs
NCBI-ProteinID: BAG19460
Kitasato: SGR2631
UniProt: B1W2U6
Position
3113593..3114510
Genome map
AA seq 305 aa AA seqDB search
MSDQNRLGVFKTYKLYVGGKFPRSESGRVYEVTDSKGQWLANAPQSSRKDARDAVVAARK
AFGGWSGATAYNRGQVLYRVAEMLEGRKEQFVREVAASEGLSKSKAAAVVDAAIDRWVWY
AGWTDKIGQISGGANPVAGPFFNLSTPEPTGVVAVLAPRKSSLLGLVSVIAPVIATGNTA
VVVASADAPLPALSLGEVLATSDVPGGVVNILSGVTAEIAAPLAAHQDVNAIDLTGADAA
LAKELEIAAADNLKRVLRPRPAGADGASDSTDWSAAPGTHRLTAFLETKTVWHPTGALGA
SGSSY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcagaaccgtcttggcgtcttcaagacctacaagctgtacgtcgggggcaag
ttcccccgctccgagagcggccgggtgtacgaggtgaccgactccaagggccagtggctc
gccaacgcgccgcagtcctcccgcaaggacgcgcgcgacgcggtcgtggccgcgcgcaag
gcgttcggcggctggtcgggcgcgaccgcgtacaaccgcggccaggtcctctaccgggtc
gccgagatgctggagggccgcaaggagcagttcgtccgcgaggtcgcggcgtccgagggg
ctgtcgaagtccaaggcggcggccgtcgtcgacgcggcgatcgaccgctgggtctggtac
gcgggctggaccgacaagatcgggcagatctccggcggggcgaacccggtcgcgggcccc
ttcttcaacctctccaccccggagccgaccggtgtggtcgcggtcctcgcgccgcggaag
tcctcgctgctcggcctggtctcggtgatcgccccggtgatcgcgaccggcaacacggcc
gtcgtcgtcgcctcggcggacgcccccctgcccgcgctgtcgctgggcgaggtactggcc
acctccgacgtgcccggcggtgtggtcaacatcctgtcgggcgtcacggcggagatcgcg
gcgccgctcgccgcccaccaggacgtcaacgcgatcgacctcaccggcgcggacgccgcg
ctggcgaaggagctggagatcgcggcggcggacaacctgaagcgcgtgctgcgcccgcgg
cccgcgggggccgacggcgcgtccgactccaccgactggtcggccgcccccggcacgcac
cgcctgacggcgttcctggagaccaagacggtgtggcacccgacgggcgccctgggagcc
tccggctcctcgtactga

DBGET integrated database retrieval system