KEGG   Streptomyces griseus: SGR_2632Help
Entry
SGR_2632          CDS       T00691                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3114586..3115005)
Genome map
AA seq 139 aa AA seqDB search
MALHARKPERRALLRAGLTITALGAALGAGAGSAGAVQLPPVAEIPDQGASALQAVGETA
GPAVTSALGTSLASSVAPITDLQLDPLANTGVDPLDNAVGTQIADFQPLTTAVLTDPITS
GGSLSDLPVVGTVTGLVTG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggcacttcatgcacgtaagcccgagcgtcgcgccctgctgcgcgccggtctgaccatc
accgccctgggggccgccctgggcgccggcgcgggctccgccggggccgttcagctgccc
ccggtcgcggagatcccggaccagggcgcctcggcgctccaggcggtcggcgagaccgcc
ggaccggcggtgaccagcgcgctcgggacctcgctggccagcagtgtcgccccgatcacc
gacctccagctggacccgctggccaacaccggggtggaccccctggacaacgccgtgggc
acccagatcgcggacttccagccgctgaccacggccgtcctcacggacccgatcaccagc
ggcggctcgctgagcgatctgcccgtggtggggacggtgaccgggctcgtcaccggctga

DBGET integrated database retrieval system