KEGG   Streptomyces griseus: SGR_2633Help
Entry
SGR_2633          CDS       T00691                                 

Definition
(GenBank) putative ATP-binding protein
  KO
K00876  
uridine kinase [EC:2.7.1.48]
Organism
sgr  Streptomyces griseus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SGR_2633
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine kinase
     SGR_2633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3115065..3115778
Genome map
AA seq 237 aa AA seqDB search
MMLDTNRRPEGSPARVNASHFCSVSSQPIPTRVVLLAGPSGSGKSVLAARTGLPVLRLDD
FYKEHDDPTLPRVPGSTDIDWDSAGSWDADAAVAAIAELCRCGRTDVPVYDIATSSRTDH
EVFHIERSPLFVAEGIFAADIVARCQELGLLADALCLRGRPSTTFRRRLVRDLREGRKSV
PFLLRRGWRLMRAERRIVARQTALGAHPCGKEEALGRFAAAAAGRCRRAGVGAPVPE
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gtgatgctggataccaacaggaggcccgaggggtcccctgcgcgggtcaatgcctcacac
ttctgttctgtgagttcccaaccgatcccgacccgcgtcgtgctgctcgcgggcccttcc
ggctccggcaagtccgtcctggccgcccgcaccggcctcccggtgctgcgcctggacgac
ttctacaaggagcacgacgacccgacgctgccgcgggtccccggctccacggacatcgac
tgggactccgccgggtcctgggacgcggacgcggcggtggccgccatcgccgagctgtgc
cggtgcgggcgcacggacgtgccggtgtacgacatcgccaccagctcccgtacggaccac
gaggtcttccacatcgagcggtcaccgctgttcgtggccgagggcatcttcgcggcggac
atcgtggcgcgctgccaggaactgggcctgctggccgacgcgctgtgcctgcgcggccgt
ccgtccaccacgttccgccgccgcctggtgcgggatctgcgcgagggccgcaagtcggtg
ccgttcctgctgcggcggggctggcggctgatgcgggccgaacgccgcatcgtggcccgc
cagacggcgctgggggcgcacccctgcggcaaggaggaggcgctggggcggttcgccgcc
gcggcggcggggcggtgccgccgggcgggcgtgggggctccggtcccggagtga

DBGET integrated database retrieval system