KEGG   Streptomyces griseus: SGR_2651Help
Entry
SGR_2651          CDS       T00691                                 

Definition
(GenBank) putative sugar ABC transporter permease protein
  KO
K02057  
simple sugar transport system permease protein
Organism
sgr  Streptomyces griseus
Module
Putative simple sugar transport system
Brite
Transporters [BR:sgr02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    SGR_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3133846..3135108)
Genome map
AA seq 420 aa AA seqDB search
MSTSTSIAARPTPLKGGRRKLSLPVVLLIIAGALALVSLVRLISGANDVTSVGQVAGALE
LAVPIGLAGLGGLWAERAGVVNIGLEGMMVLGTWFGAWAGFQWGPWVGVLFGVLGGCLGG
LLHAVITVTFGVNHIVSGVAINILAVGVTRYLSNFAFDGIQGGSSKQSPRIDPIDKITIP
GLSDWLQDLQQQHWFLISDIAGILGGLVTGLSLLTVVALLLIPATWWILWRTPFGLRLRS
CGESPVAAETLGVNVYKYKYIAVTVSGGLAGLGGAFLAIVATGIYQEGQTGGRGYIGLAA
MIFGNWMPGGMALGAGLFGFTDSLKLRGGAENVHAMLLLLAILLVIAVFWQLYRKKYVAA
AISAVVSALLFTWYLLTDQVPSQFVDAAPYVTTLLVLSLSAQRLRMPKADGVPYRKGEGK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgagcacgtccatcgccgcacggcccacccccctcaagggcggccgccgcaag
ctctccctgcccgtcgtcctcctgatcatcgcgggtgcgctcgccctggtctccctcgtg
cgcctcatcagcggcgccaacgacgtcacctcggtcggccaggtcgccggcgccctggaa
ctggccgtcccgatcggcctcgccggactcggcggcctgtgggccgagcgcgcgggcgtc
gtcaacatcggcctcgaaggcatgatggtcctgggcacctggttcggcgcctgggccgga
ttccagtggggtccctgggtgggcgtcctcttcggcgtcctcggcggctgcctcggcggc
ctgctgcacgcggtcatcaccgtcaccttcggcgtgaaccacatcgtctccggtgtggcc
atcaacatcctcgccgtcggcgtcacccgctacctctccaacttcgccttcgacggcatc
cagggcggctcctccaagcagtccccgcgcatcgatccgatcgacaagatcaccattccg
ggcctctcggactggttgcaggacctgcaacaacagcactggttcctgatctccgacatc
gcgggcatcctcggcggcctggtcaccggactctccctgctgaccgtcgtcgccctgctg
ctgatccccgccacctggtggatcctgtggcgcaccccgttcgggctgcggctgcgctcc
tgcggcgagtccccggtggccgccgagaccctcggcgtcaacgtgtacaagtacaagtac
atcgccgtcaccgtctccggcggtctggcgggcctcggcggagcgttcctcgcgatcgtc
gccaccggcatctaccaggagggccagaccggcggtcgcggctacatcggtctcgccgcc
atgatcttcggcaactggatgccgggcggcatggcgctgggcgccggactcttcggcttc
accgacagcctcaagctgcgcggcggcgcggagaacgtccacgcgatgctgctcctgctg
gcgatcctgctggtcatcgcggtgttctggcagctgtaccggaagaagtacgtcgccgcg
gcgatctcggcggtcgtctcggcgctgctgttcacctggtacctcctgaccgaccaggtg
ccgagccagttcgtcgacgccgccccgtacgtcacgacgctgctggtcctctcgctctcc
gcgcaacggctgcggatgcccaaggcggacggcgtgccgtaccgcaagggcgagggcaag
tga

DBGET integrated database retrieval system