KEGG   Streptomyces griseus: SGR_2657Help
Entry
SGR_2657          CDS       T00691                                 

Definition
(GenBank) hypothetical protein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3142083..3142520
Genome map
AA seq 145 aa AA seqDB search
MSGPDDSPSVLYASERTFRVWRYGVGHSHLLLRSLPDGEDTTQLDLRFEMVRAMRLVTRY
EALRVVSVDAGEFSRVFAESGVPPVRRHTQLVVGLRSRTGTGYVQCGRVVLDRREGRTCD
GEDPPGPRDVVWSLRPGGPVPPSSP
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggtcccgacgacagcccgtccgtcctctacgcgtccgagcgcacgttccgtgtc
tggcggtacggggtcgggcactcgcacctgctgctccgctccctgccggacggcgaggac
accacgcagctcgacctgcgcttcgagatggtccgcgccatgcggctcgtcacccgctac
gaggcgctccgcgtcgtctccgtcgacgcgggcgagttctcgcgcgtcttcgcggagtcg
ggtgttccgcccgtccggcggcacacgcagctcgtcgtcgggctgcgctcccgcaccggc
acggggtacgtgcagtgcgggcgcgtggtcctggaccgccgggaggggcggacgtgcgac
ggagaggatccgcccggtccccgggacgtggtctggagtctgcggcccggtggtcccgtg
cctccgtcctcgccctga

DBGET integrated database retrieval system