KEGG   Streptomyces griseus: SGR_2658Help
Entry
SGR_2658          CDS       T00691                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAG19487
Kitasato: SGR2658
UniProt: B1W2X3
Position
complement(3142539..3143573)
Genome map
AA seq 344 aa AA seqDB search
MNLAFVESPVQLLNVLEWVHTQGGDDPAGTTVVVLPPVDPMSRGQLRRMAELARDEGITV
RWQEARGESGAPLKALRALAGLVRRADHIVIGDPFSRYVQLLLTLVRADHLTVVDDGTAT
MEFVAQLARGERLARWHRRGRTGPRELVLAPVTATARRRFTPTEHHTVQVFTAMPVEAPP
GIAVTPNTFAWTRARFGPPSIGRGADLVGTSLVETGVVDPVPYQEAVTALARAHGATRYF
AHRRESAEKLHALEAATGLEIVRPDLPLELIARRGPIGRTIVSFPSTVVHTLPLALAGTG
VNVAVCDIAPEWLRATASPRAQGFLSGVTETARGVQRLTSTAHA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctcgccttcgtcgagagcccggtccagctcctgaacgtcctggagtgggttcac
acccaggggggagacgatccggccggcaccacggtcgtcgtcctccccccggtcgacccg
atgtcgcgcggtcagctgcgccggatggcggagctggcccgcgacgagggcatcacggtc
cgctggcaggaggcgcgcggcgagtccggcgcccccctgaaggccctgcgcgccctggcc
ggcctggtccggcgcgcggaccacatcgtgatcggcgacccgttctcccgctatgtgcag
ctcctgctgaccctggtccgcgccgatcacctcacggtggtcgacgacggcacggccacc
atggagttcgtcgcccagctggcccggggcgaacggctggcgcgctggcaccgccggggc
cgcacgggaccgcgtgaactggtcctggccccggtgacggcgacggcccgccgccgcttc
accccgacggagcaccacacggtccaggtgttcaccgccatgccggtcgaggctccgccc
ggcatcgcggtcaccccgaacaccttcgcctggacccgggcccgcttcggcccgcccagc
atcggcaggggcgcggacctggtcggcacctccctggtcgagacgggcgtcgtcgacccc
gtcccgtaccaggaggccgtcacggccctggcccgcgcccacggagccacccgctacttc
gcccaccgccgcgagtccgccgagaagctccacgccctggaagccgccaccggcctggag
atcgtccgcccggacctccccctggagctcatcgcccgccgcggccccatcggccgcacg
atcgtcagcttcccctccacggtcgtccacaccctcccgctggccctggccggcacgggc
gtgaacgtcgcggtctgcgacatcgccccggagtggctccgcgccacggcctcgccgcgc
gcgcagggcttcctgagcggggtcacggagacggcgcggggggtgcagcggctgacctcg
acggcccacgcgtag

DBGET integrated database retrieval system