KEGG   Streptomyces griseus: SGR_2659Help
Entry
SGR_2659          CDS       T00691                                 

Definition
(GenBank) putative N-acetylneuraminic acid (Neu5Ac) synthase
  KO
K01654  
N-acetylneuraminate synthase [EC:2.5.1.56]
Organism
sgr  Streptomyces griseus
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SGR_2659
Enzymes [BR:sgr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.56  N-acetylneuraminate synthase
     SGR_2659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3143584..3144516)
Genome map
AA seq 310 aa AA seqDB search
MSTSRLRTFGTRTAGPGNPVYITGEIGINHNGDLDNAIALIDAAAEAGCDAVKFQKRTPE
ICTPRDQWDIERDTPWGRMTYIDYRHRVEFGEAEYTAIAEHCAERGIDWFASPWDTEAVA
FLEKFDVPAHKVASASLTDDELLRALRATGRTVILSTGMSTPKQIRHAVEVLGSDNILLC
HATSTYPAKAEELNLRVINTLQQEYPNVPIGYSGHETGLQTTLAAVALGATFVERHITLD
RAMWGSDQAASVEPQGLTRLVRDIRTIEQSLGDGVKKVYESELGPMKKLRRVAGVVAETE
NAPAPEPVAV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctcccgcctgcgcaccttcggcacccgcaccgccggccccggcaaccccgtc
tacatcaccggcgagatcggcatcaaccacaacggcgacctcgacaacgccatcgcgctg
atcgacgccgccgccgaagccggctgcgacgccgtcaagttccagaagcgcaccccggag
atctgcaccccgcgcgaccagtgggacatcgagcgcgacaccccctggggccggatgacg
tacatcgactaccgccaccgcgtcgagttcggcgaggccgagtacaccgccatcgccgag
cactgcgccgagcgcggcatcgactggttcgcctccccgtgggacaccgaggccgtcgcc
ttcctggagaagttcgacgtccccgcccacaaggtggcgtccgcgtccctcaccgacgac
gagctgctgcgcgccctgcgcgccaccggccgcacggtcatcctctccacgggcatgtcg
accccgaagcagatccgccacgcggtcgaggtcctcggttcggacaacatcctgctctgc
cacgccacgtccacgtacccggcgaaggccgaggagctgaacctgcgggtcatcaacacc
ctccagcaggagtacccgaacgtcccgatcggctactccggccacgagacgggcctccag
accacgctggccgccgtcgcgctcggcgccacgttcgtcgagcgccacatcaccctggac
cgcgccatgtggggctccgaccaggccgcctccgtcgagccgcagggcctgacccgcctg
gtccgcgacatccgcaccatcgagcagtcgctcggcgacggcgtcaagaaggtgtacgag
tccgagctcggcccgatgaagaagctccgccgcgtcgcgggcgtcgtcgccgagaccgag
aacgcgccggcccccgagccggtcgcggtctga

DBGET integrated database retrieval system