KEGG   Streptomyces griseus: SGR_2660Help
Entry
SGR_2660          CDS       T00691                                 

Definition
(GenBank) putative transferase
  KO
K00983  N-acylneuraminate cytidylyltransferase [EC:2.7.7.43]
Organism
sgr  Streptomyces griseus
Pathway
sgr00520  Amino sugar and nucleotide sugar metabolism
sgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SGR_2660
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.43  N-acylneuraminate cytidylyltransferase
     SGR_2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_3 Hydrolase_3 NTP_transf_3 IspD Hydrolase HAD
Motif
Other DBs
NCBI-ProteinID: BAG19489
Kitasato: SGR2660
UniProt: B1W3I3
Position
complement(3144529..3145821)
Genome map
AA seq 430 aa AA seqDB search
MTTPSATAMTPGAAMQPPPTPTVLAVIPARGGSKGVPAKNLAEVGGIPLVARAVRAALAA
PEVTDVVVTTDDGAIAEAARTAAADLRAAHRLHCVERPAAIAGDTATSEAAVLHAMDVYE
AERARTVDVVLLVQCTSPFVSRDDIDGVARAVAREGADTAVTVAPFHGFVWRDGHAVEEG
TYGVNHDKSVRPRRQDRPQDHLETGAAYAMDAAGFRTHRHRFFGHTALVPTDPARVLEID
DPHDLARARALAPLLDPSPLPSLGDVDAVVLDFDGTQTDDRVMIDSDGRETVAVHRGDGL
GIAALRKAGVPLLILSTEQNPVVAARARKLRIPVLHGIDRKDEALKRWCDEHSIAPDRVL
YVGNDVNDLPCFSLAGWPVAVASAHDSVRAAARAVTTTPGGYGAIREIAAWLLGPTLTTT
NTPDPTVPTT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccccttcagccaccgccatgacaccaggagcagcgatgcagccgcccccgacc
ccgaccgtcctcgccgtgatccccgcccgcggcggatccaagggcgtccccgccaagaac
ctcgccgaggtcggcggcatccccctggtcgcccgtgccgtccgcgccgcgctcgccgcc
cccgaggtcaccgacgtcgtcgtcaccaccgacgacggggcgatcgccgaggccgcccgc
accgccgccgccgacctccgcgccgcccaccggctgcactgcgtcgagcgccccgccgcc
atcgcgggcgacacggccaccagcgaagcggccgtgctgcacgcgatggacgtctacgag
gccgagcgcgcccgcaccgtcgacgtggtcctcctcgtccagtgcaccagcccgttcgtc
tcccgcgacgacatcgacggggtcgccagggcggtggcccgcgaaggggcggacacggcc
gtcacggtcgccccgttccacggattcgtctggcgcgacgggcacgcggtcgaggagggc
acgtacggcgtcaaccacgacaagtccgtacgcccccgccgccaggaccgcccccaggac
cacctggagaccggcgccgcctacgcgatggacgccgcgggcttccgcacccaccgccac
cgcttcttcggccacaccgccctggtccccaccgacccggcccgggtgctggagatcgac
gacccgcacgacctggcccgcgcccgcgcgctcgccccgctcctcgacccctccccgctg
ccctccctcggggacgtggacgcggtcgtcctcgacttcgacggcacccagaccgacgac
cgggtcatgatcgactccgacggccgcgagaccgtcgccgtgcaccggggcgacgggctc
ggcatcgccgcgctgcgcaaggccggggtccccctcctgatcctctccaccgagcagaac
ccggtcgtcgccgcccgcgcccgcaagctccggatccccgtcctgcacggcatcgaccgc
aaggacgaggcgctgaagcgctggtgcgacgagcactccatcgcccccgaccgggtcctc
tacgtcggcaacgacgtcaacgacctgccctgcttctcgctggccggctggcccgtcgcc
gtcgcgagcgcccacgactcggtacgcgccgccgcgcgcgccgtcacgaccacccccggc
ggctacggcgccatccgcgagatcgcggcctggctgctgggccccaccctcaccaccacc
aacacccctgaccccacagtccccaccacgtaa

DBGET integrated database retrieval system