KEGG   Streptomyces griseus: SGR_2662Help
Entry
SGR_2662          CDS       T00691                                 

Definition
(GenBank) putative glycosyl transferase
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: BAG19491
Kitasato: SGR2662
UniProt: B1W3I5
Position
3147412..3148395
Genome map
AA seq 327 aa AA seqDB search
MVKLSVIVPFFNVQTYAPDTLRSLRANAREDFEFLLVDDCSTDGTPRLLRRAADEIPGAV
LLRHEVNGGLATARNTGLAAARGEYIAFLDGDDWLAPGHYARLVARTEALGCDFVRTDHV
RADGRTRTVRRVPHGPHGVVSDPRAAILPAHRTTSVDYAFAWAGLYHRRLLDRGLLHFTD
GLRTAEDRPWIWRLHREAESFATLGLLSHFYRRGVATSLTRIGDVRRLDFLRAFDQVIAE
TAADRDADALLPKAVRTYCAVIAHHLGALDACEPAVARELKSRGAAALGRLPQRLLDEAL
DAMDVTRATRVRRLRRRPVAAKGASAA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtggttaagctctccgtcatcgtgccgttcttcaacgtgcagacctacgcgcccgacacc
ctcagaagtctgcgggccaacgcccgcgaggacttcgagttccttctcgtcgacgactgt
tcgaccgacgggacaccccggctgctgcgccgggccgccgacgagattcccggagcggta
ctgctgcggcacgaggtgaacggcggtctcgcgaccgcgcgcaacaccggcctggcggcg
gcgcgcggcgagtacatcgccttcctcgacggcgacgactggctggcccccgggcactac
gcacggctggtggccaggaccgaggcgctgggctgcgacttcgtgcgcaccgaccacgtc
cgggcggacggcaggacgcggacggtgcgccgggtcccgcacgggccgcacggggtggtg
agcgacccccgggcggcgatcctgcccgcccaccgcaccacttcggtggactacgcgttc
gcctgggcgggcctctaccaccggcggctgctggaccgggggctgctgcacttcaccgac
gggctgcgcacggccgaggaccggccgtggatctggcggctgcaccgggaggcggaatcc
ttcgccaccctgggcctgctcagccatttctaccggcgcggagtggccacgtcactgacc
cggatcggcgatgtgcggcggctcgatttcctgcgcgctttcgaccaggtgatcgccgag
acggccgccgaccgtgacgcggacgctctgctgccgaaggccgtacgcacgtattgcgcg
gtcatcgcccatcatctgggcgccctcgacgcatgcgaaccggccgtggcccgcgaactg
aagtcgcgcggcgcggcggccctgggacgcctgccgcagcggctcctggacgaggcgctc
gacgccatggacgtgacacgagcgacccgggtgcgcaggctgcgccgccgtccggtcgcc
gcgaagggggcctcggccgcatga

DBGET integrated database retrieval system