KEGG   Streptomyces griseus: SGR_2685Help
Entry
SGR_2685          CDS       T00691                                 

Definition
(GenBank) putative beta-N-acetylglucosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
sgr  Streptomyces griseus
Pathway
sgr00511  Other glycan degradation
sgr00520  Amino sugar and nucleotide sugar metabolism
sgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SGR_2685
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SGR_2685
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SGR_2685
Chaperones and folding catalysts [BR:sgr03110]
 Intramolecular chaperones
  Others
   SGR_2685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: BAG19514
Kitasato: SGR2685
UniProt: B1W3K8
Position
complement(3175915..3177525)
Genome map
AA seq 536 aa AA seqDB search
MSPTRGALVTGAAVTAAAAVALTVVVWPEGSGSGPSGETASPSGTSAEAVAPSPSRSYPM
SSTPSTIPAVREHTPARGPGWQPGKDSTVVIARGSQVLADEAELLAKELKIRYRGAEPAK
AGDVELALGDKDAGPAESYTLTVRDRKARITGPDESGVFYGTRTLKQSLKADGTLPEGVV
NDRPDRPQRGLNLDIARKHYSAEWIEDRIREMGDLKLNQLGLHFSDDQAFRIESKSHPEV
VSDEALTQDEVRRIVALANSRHIEVVPEIDSPGHLGAVLAAHPDLQLRNTAGVESKGSID
ISKPGAAKLIDELLDEYTELFPGRFWHLGADEYQALTVRNPAASYPQLQRAAEKKYGAGA
SIEDLATGWLNDRADVVVPKGRTAKAWNDGLFRDTEVKADENIEIEYWTGKEIGARPPQE
YLAAGYKMLNLNDEFLYYVLGEPNEFVYPTGERIYEQWTPLVLRGTEPVAERYSRQILGG
RFAVWGDLPNAQTTQQVADGIRMPLVATSQKLWDPRKPALSWAQFQELAERTGSAG
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccacgcgtggtgccctcgtcaccggcgcggctgtcacggccgcggccgccgtc
gccctcaccgtcgtcgtctggccggaggggtccggcagcggaccgtccggcgaaaccgcg
tcgccctccggcacctcggccgaggccgtcgccccgtcgccctcccgcagctacccgatg
tccagcacaccgagcacgatccccgcggtgcgcgagcacaccccggcccgggggcccggc
tggcagccgggcaaggacagcaccgtcgtcatcgccaggggcagccaggtgctcgccgac
gaggcggagctgctcgccaaggagctgaagatccgctaccggggcgcggaaccggcgaag
gcgggagacgtcgagctggcgctcggcgacaaggacgcgggccccgccgagtcgtacacg
ctcaccgtgcgcgaccggaaggcgaggatcaccggacccgacgaatcgggcgtcttctac
ggcacccgtacgctcaagcagtccctcaaggcggacggcacgctccccgagggcgtcgtc
aacgaccggccggaccggccgcagcgcggactcaacctcgacatcgcccgcaagcactac
agcgcggagtggatagaggaccgcatacgcgagatgggcgacctcaagctcaaccagctc
ggcctgcacttctccgacgaccaggccttccggatcgagtcgaagtcgcaccccgaggtg
gtctccgacgaggccctcacccaggacgaggtccgccgcatcgtcgccctcgccaacagc
cggcacatcgaggtcgtccccgagatcgactcgcccggacacctcggcgcggtgctggcc
gcccacccggacctccagctgcgcaacaccgcgggcgtggagtcgaagggctccatcgac
atctcgaagccgggcgcggccaagctgatcgacgaactcctcgacgagtacaccgagctg
ttccccgggcgcttctggcacctgggcgcggacgagtaccaggcgctgaccgtccggaac
ccggccgcctcctatccgcagctccagcgcgcggcggagaagaagtacggggccggggcc
tcgatcgaggacctggccaccggctggctgaacgaccgcgcggacgtcgtcgtcccgaag
ggccggacggccaaggcctggaacgacggactgttccgcgacaccgaggtcaaggccgac
gagaacatcgagatcgagtactggaccggcaaggagatcggcgcccgcccgccgcaggag
tacctcgccgcgggctacaagatgctgaacctcaacgacgagttcctctactacgtgctc
ggcgagcccaacgagttcgtctacccgaccggcgagcgcatctacgagcagtggaccccg
ctggtcctgcgcggcaccgaacccgtggcggagcgctactcgcggcagatcctcggcggc
cggttcgccgtctggggcgacctgccgaacgcgcagaccacccagcaggtggcggacggc
atcaggatgccgctggtggcgacctcgcagaagctgtgggatccccggaaaccggcgctg
agctgggcacagttccaggaactggcggagcggaccggcagcgcgggctga

DBGET integrated database retrieval system