KEGG   Streptomyces griseus: SGR_2688Help
Entry
SGR_2688          CDS       T00691                                 

Definition
succinate dehydrogenase membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sgr  Streptomyces griseus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGR_2688
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SGR_2688
   00650 Butanoate metabolism
    SGR_2688
  Energy metabolism
   00190 Oxidative phosphorylation
    SGR_2688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
3179143..3179625
Genome map
AA seq 160 aa AA seqDB search
MSSETSSAAAIGDVEGVSLYDVDHPAPVIEPPRKRTAKTPKASRGNFEMYAWLFMRLSGI
LLTVLVIGHLLIQLVLDGGVSKIGFAFVAGRWASPFWQVWDLTMLWLAMLHGGNGLRTVI
NDYAERDNTRFWLKMLLYTATVFTVLLGTLVIFTFDPNIR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgagacttcttccgcagccgcgatcggcgatgtcgagggcgtgagcctgtac
gacgtcgaccacccggccccggtgatcgagcccccgcgcaagcggacggccaagacgccc
aaggcctcgcgcggcaacttcgagatgtacgcctggctcttcatgcgcctgtcgggcatc
ctcctgaccgtcctcgtcatcggccacctgctgatccagctggtgctcgacggcggcgtc
tccaagatcggcttcgccttcgtggcgggccgctgggcctcgccgttctggcaggtctgg
gacctgacgatgctgtggctcgccatgctccacggcggcaacggcctgcgcacggtcatc
aacgactacgccgaacgggacaacacccgcttctggctgaagatgctcctgtacaccgcc
acggtgttcaccgtcctgctgggcacgctggtgatcttcaccttcgacccgaacatccgc
tag

DBGET integrated database retrieval system