KEGG   Streptomyces griseus: SGR_2723Help
Entry
SGR_2723          CDS       T00691                                 

Definition
(GenBank) putative succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sgr  Streptomyces griseus
Pathway
sgr00020  Citrate cycle (TCA cycle)
sgr00640  Propanoate metabolism
sgr00660  C5-Branched dibasic acid metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01130  Biosynthesis of antibiotics
sgr01200  Carbon metabolism
Module
sgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SGR_2723
   00640 Propanoate metabolism
    SGR_2723
   00660 C5-Branched dibasic acid metabolism
    SGR_2723
Enzymes [BR:sgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SGR_2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: BAG19552
Kitasato: SGR2723
UniProt: B1W3P6
Position
complement(3218463..3219644)
Genome map
AA seq 393 aa AA seqDB search
MDLFEYQARDLFAKHGVPVLAGEVIDTPEAAREATEKLGGKSVVKAQVKVGGRGKAGGVK
LAADPDEAVARATDILGMDIKGHTVHKVMIAELSPEIEAEYYVSYLLDRTNRTFLAMASV
QGGMDIEEVAEKTPEALAKVPVNAVDGVDIAKAREIVAQAKFPADVAEGVAEALVTLWDT
FVAEDALLVEVNPLVKTKDGRILALDGKVSLDENADFRQPDHEALEDKDAANPLEAAAKA
KNLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGENHGNVKPANFLDIGGGASAEVMANGL
EIILGDPDVRSVFVNVFGGITACDEVANGIVQALALLESKGEKVEKPLVVRLDGNNAELG
RKILSDANHPLVQRVDTMDGAADKAAELAAAAK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaggcgagggacctcttcgccaagcacggtgtaccggtgctg
gccggtgaagtcatcgacacgcctgaggcagcccgcgaggcgaccgagaagctgggcggc
aagtctgtcgtcaaggcgcaggtgaaggtcggtggccgcggcaaggccggcggcgtgaag
ctggcggccgaccccgacgaggcggtcgcccgggcgaccgacattctcggcatggacatc
aagggccacacggtccacaaggtgatgatcgccgagctgtccccggagatcgaggcggag
tactacgtctcgtacctcctcgaccgcaccaaccgcaccttcctggccatggcctcggtg
cagggcggcatggacatcgaggaggtcgcggagaagactcccgaggccctcgcgaaggtc
cccgtcaacgccgtcgacggcgtcgacatcgccaaggcccgcgagatcgtggcccaggcg
aagttcccggccgacgtggccgagggtgtcgccgaggcgctggtgaccctgtgggacacc
ttcgtcgccgaggacgcgctcctcgtcgaggtcaaccccctggtgaagaccaaggacggc
cggatcctggccctggacggcaaggtgtctctcgacgagaacgccgacttccgccagccg
gaccacgaggccctcgaggacaaggacgcagccaacccgctcgaggctgccgccaaggcc
aagaacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggtgccggt
ctggtcatgtcgaccctggacgtcgtcgcgtacgccggtgagaaccacggcaacgtgaag
cccgccaacttcctcgacatcggtggcggcgcctccgcggaggtcatggcgaacggcctg
gagatcatcctcggcgacccggacgtccggtccgtgttcgtcaacgtcttcggtggcatc
accgcctgtgacgaggtcgccaacggcatcgtgcaggcgctcgcgctcctggagtccaag
ggcgagaaggtcgagaagccgctggtcgtgcgtctcgacggcaacaacgcggagctgggt
cgcaagatcctttccgacgccaaccacccgctcgtgcagcgcgtggacaccatggacggc
gcggccgacaaggccgccgagctcgccgcggccgcgaagtaa

DBGET integrated database retrieval system