KEGG   Streptomyces griseus: SGR_2748Help
Entry
SGR_2748          CDS       T00691                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sgr  Streptomyces griseus
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:sgr00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(3251811..3253721)
Genome map
AA seq 636 aa AA seqDB search
MSQDSHAQNRAVSPAPTDPVPASPVPAEDDAAYDYDVLVVGSGFGGAVSALRLTEKGYRV
GVLEAGRRFTPGTLPKTSWDLKNYLWAPALGLFGLQRIHLLGNVMVLAGAGVGGGSLNYA
NTLYVPPAPFFEDRQWASITDWQDELKPYYDQARRMLGVRLNPTMTPSDIHLKAVAQAMG
VGDTFHMTPVGVFFGDGKDADGTARAKAGSTVPDPYFGGAGPDRKACTECGECMTGCRHG
AKNTLNENYLYLAERAGAVIHPMTSVVAVTDDPEGGYRVLTVPTDRRRRAKPTRLRARKV
VVAAGTYGTQTLLHTMKDRGLLPRLSAKLGELTRTNSEGLVGAQTSDRRYRRKHGTAKAD
FTRGVAITSSIHPDDNTHIEPVRYGRGSNAMGALTVLQVPYGAHRVRGWIANMVKHPTLA
ARSLSNRRWSERTIIGLVMQSLDNSLTTYRKPGGVGKGLLTARQGHGAPNPTQIPEATLG
ASLLAEEINGFAGSNVGELMGTPLTAHFLGGCPIGASAEEGVIDPYHRLYGHPGISVVDG
SAVSANLGVNPSLTITAQAERAMSFWPNKGEADPRPEQGGAYERLTPVEPLAPTVPKEAF
GALKLPFLGIPVVPPKGTAEAGADVKGVGNTPVPNP
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggacagccatgcccagaaccgggccgtgagccccgcgccgacggaccctgtc
ccggcgagccctgtgccggccgaggacgacgccgcgtacgactacgacgtcctggtcgtc
ggatcgggcttcgggggcgcggtgtcggcgctccggctgaccgagaaggggtaccgcgtc
ggagtcctggaggcgggccgccgcttcacccccggcaccctccccaagacctcctgggac
ctgaagaactacctctgggcgcccgccctcggcctcttcggcctccagcgcatccacctc
ctcggcaacgtcatggtgctcgccggggccggggtcggcggcggatcgctcaactacgcc
aacaccctgtacgtgccgcccgccccgttcttcgaggaccgccagtgggcctcgatcacc
gactggcaggacgagctgaagccgtactacgaccaggcccgccggatgctcggggtccgt
ctcaacccgacgatgaccccgtccgacatccacctcaaggccgtcgcgcaggccatgggc
gtcggcgacaccttccacatgaccccggtcggcgtcttcttcggcgacggcaaggacgcc
gacggcaccgcgcgggccaaggccggctccaccgtccccgatccgtacttcggcggcgcg
ggccccgaccgcaaggcctgcaccgagtgcggcgagtgcatgacgggctgccgccacggc
gcgaagaacaccctcaacgagaactacctgtacctcgccgagcgggccggagcggttatc
cacccgatgacctccgtcgtcgccgtcaccgacgaccccgagggcggctaccgcgtcctc
acggtccccaccgaccgccgccgccgggcgaagcccacgaggctgcgcgcccgcaaggtc
gtcgtcgccgccgggacgtacggcacccagaccctcctgcacaccatgaaggaccgggga
ctgctgccccgcctctccgcgaagctcggcgagctgacccggaccaactccgagggtctg
gtgggcgcgcagaccagcgaccgccgctaccgcaggaagcacggcaccgccaaggccgac
ttcacccggggcgtcgccatcacctcgtcgatccaccccgacgacaacacccacatcgag
cccgtccgctacggccggggctccaacgccatgggcgcgctgacggtcctccaggtcccc
tacggggcccaccgggtgcgcggctggatcgccaacatggtcaagcaccccaccctcgcc
gcccgttcgctctccaaccgccgctggtccgagcgcaccatcatcggcctggtcatgcag
tcgctggacaactccctgaccacgtaccgcaaaccgggcggcgtcggaaagggcctgctc
accgcccgccagggccacggcgcccccaacccgacgcagatcccggaggcgaccctcggc
gcgagcctgctcgccgaggagatcaacggcttcgccgggtccaacgtcggcgagctgatg
ggcaccccgctcaccgcccacttcctcggcggctgcccgatcggcgcgagcgccgaggaa
ggcgtcatcgacccgtaccaccggctctacggccaccccggcatcagcgtcgtcgacggc
tccgcggtctccgccaacctcggcgtcaacccctcgctgaccatcacggcccaggccgaa
cgcgcgatgtccttctggcccaacaagggcgaggcggacccgcgcccggagcagggcggg
gcctacgagcggctcacccccgtcgagccgctcgcgccgaccgtgccgaaggaggcgttc
ggcgcgctgaagctgccgttcctgggcatccccgtggtgccgccgaaggggacggcggag
gccggggcggacgtgaagggcgtcgggaacacacccgtacccaatccgtga

DBGET integrated database retrieval system