KEGG   Streptomyces griseus: SGR_2748Help
Entry
SGR_2748          CDS       T00691                                 

Definition
(GenBank) putative cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
sgr  Streptomyces griseus
Pathway
sgr00984  Steroid degradation
sgr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SGR_2748
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SGR_2748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 Fer4_9 Fer4_10 Fer4 Pyr_redox Fer4_6
Motif
Other DBs
NCBI-ProteinID: BAG19577
Kitasato: SGR2748
UniProt: B1W3S1
Position
complement(3251811..3253721)
Genome map
AA seq 636 aa AA seqDB search
MSQDSHAQNRAVSPAPTDPVPASPVPAEDDAAYDYDVLVVGSGFGGAVSALRLTEKGYRV
GVLEAGRRFTPGTLPKTSWDLKNYLWAPALGLFGLQRIHLLGNVMVLAGAGVGGGSLNYA
NTLYVPPAPFFEDRQWASITDWQDELKPYYDQARRMLGVRLNPTMTPSDIHLKAVAQAMG
VGDTFHMTPVGVFFGDGKDADGTARAKAGSTVPDPYFGGAGPDRKACTECGECMTGCRHG
AKNTLNENYLYLAERAGAVIHPMTSVVAVTDDPEGGYRVLTVPTDRRRRAKPTRLRARKV
VVAAGTYGTQTLLHTMKDRGLLPRLSAKLGELTRTNSEGLVGAQTSDRRYRRKHGTAKAD
FTRGVAITSSIHPDDNTHIEPVRYGRGSNAMGALTVLQVPYGAHRVRGWIANMVKHPTLA
ARSLSNRRWSERTIIGLVMQSLDNSLTTYRKPGGVGKGLLTARQGHGAPNPTQIPEATLG
ASLLAEEINGFAGSNVGELMGTPLTAHFLGGCPIGASAEEGVIDPYHRLYGHPGISVVDG
SAVSANLGVNPSLTITAQAERAMSFWPNKGEADPRPEQGGAYERLTPVEPLAPTVPKEAF
GALKLPFLGIPVVPPKGTAEAGADVKGVGNTPVPNP
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggacagccatgcccagaaccgggccgtgagccccgcgccgacggaccctgtc
ccggcgagccctgtgccggccgaggacgacgccgcgtacgactacgacgtcctggtcgtc
ggatcgggcttcgggggcgcggtgtcggcgctccggctgaccgagaaggggtaccgcgtc
ggagtcctggaggcgggccgccgcttcacccccggcaccctccccaagacctcctgggac
ctgaagaactacctctgggcgcccgccctcggcctcttcggcctccagcgcatccacctc
ctcggcaacgtcatggtgctcgccggggccggggtcggcggcggatcgctcaactacgcc
aacaccctgtacgtgccgcccgccccgttcttcgaggaccgccagtgggcctcgatcacc
gactggcaggacgagctgaagccgtactacgaccaggcccgccggatgctcggggtccgt
ctcaacccgacgatgaccccgtccgacatccacctcaaggccgtcgcgcaggccatgggc
gtcggcgacaccttccacatgaccccggtcggcgtcttcttcggcgacggcaaggacgcc
gacggcaccgcgcgggccaaggccggctccaccgtccccgatccgtacttcggcggcgcg
ggccccgaccgcaaggcctgcaccgagtgcggcgagtgcatgacgggctgccgccacggc
gcgaagaacaccctcaacgagaactacctgtacctcgccgagcgggccggagcggttatc
cacccgatgacctccgtcgtcgccgtcaccgacgaccccgagggcggctaccgcgtcctc
acggtccccaccgaccgccgccgccgggcgaagcccacgaggctgcgcgcccgcaaggtc
gtcgtcgccgccgggacgtacggcacccagaccctcctgcacaccatgaaggaccgggga
ctgctgccccgcctctccgcgaagctcggcgagctgacccggaccaactccgagggtctg
gtgggcgcgcagaccagcgaccgccgctaccgcaggaagcacggcaccgccaaggccgac
ttcacccggggcgtcgccatcacctcgtcgatccaccccgacgacaacacccacatcgag
cccgtccgctacggccggggctccaacgccatgggcgcgctgacggtcctccaggtcccc
tacggggcccaccgggtgcgcggctggatcgccaacatggtcaagcaccccaccctcgcc
gcccgttcgctctccaaccgccgctggtccgagcgcaccatcatcggcctggtcatgcag
tcgctggacaactccctgaccacgtaccgcaaaccgggcggcgtcggaaagggcctgctc
accgcccgccagggccacggcgcccccaacccgacgcagatcccggaggcgaccctcggc
gcgagcctgctcgccgaggagatcaacggcttcgccgggtccaacgtcggcgagctgatg
ggcaccccgctcaccgcccacttcctcggcggctgcccgatcggcgcgagcgccgaggaa
ggcgtcatcgacccgtaccaccggctctacggccaccccggcatcagcgtcgtcgacggc
tccgcggtctccgccaacctcggcgtcaacccctcgctgaccatcacggcccaggccgaa
cgcgcgatgtccttctggcccaacaagggcgaggcggacccgcgcccggagcagggcggg
gcctacgagcggctcacccccgtcgagccgctcgcgccgaccgtgccgaaggaggcgttc
ggcgcgctgaagctgccgttcctgggcatccccgtggtgccgccgaaggggacggcggag
gccggggcggacgtgaagggcgtcgggaacacacccgtacccaatccgtga

DBGET integrated database retrieval system