KEGG   Streptomyces griseus: SGR_3228Help
Entry
SGR_3228          CDS       T00691                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sgr  Streptomyces griseus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGR_3228
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGR_3228
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SGR_3228
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SGR_3228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(3748910..3750211)
Genome map
AA seq 433 aa AA seqDB search
MAVQTVAGSTASSTPAVDLGPAAALSCRECGERFELGPLFACASCFGPLEVAYDLPTGSP
EELRKRIEAGPDNIWRYAPLLPVPADVAEKPNINPGFTKLVKADNLARELGVTGGLYVKD
DSGNPTHSFKDRVVAIAVEAARAFGFTTLSCSSTGNLAGAVGAAAARAGLRSCVFIPHDL
EQGKVVMAAVYGGELVGIEGNYDDVNRFCSELIGDPLGEGWGFVNVNLRPYYGEGSKTLA
YEICEQLGWRLPDQIVIPIASGSQLTKIDKGLQELIKLGLVEDKPYKIFGAQAEGCSPVS
AAFKAGHDVVRPQKPNTIAKSLAIGNPADGPYVLDIARRTGGAVEDVTDEQVVDAIKLLA
RTEGIFGETAGGVTLGVTKKLIEAGVIDPTLTTVVVNTGDGLKTLDAVSATSQATATIKP
SLEAFRAAGLGTA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcagaccgttgcaggcagcaccgcttcgtccaccccggccgtcgacctcggc
cccgccgcggcgctttcctgccgcgagtgcggcgagcgtttcgagctcggcccccttttc
gcctgtgcgtcctgtttcgggcccctcgaagtggcctacgacctgcccaccggctcgccc
gaggagctgcgcaagcgcatcgaggccggcccggacaacatctggcgctacgccccgctc
ctgccggtgcccgcggacgtcgcggagaagcccaacatcaaccccggcttcaccaagctc
gtcaaggccgacaacctcgcccgcgagctgggcgtcaccggcggcctgtacgtgaaggac
gactccggcaacccgacgcactccttcaaggaccgcgtcgtcgccatcgccgtcgaggcc
gcccgcgccttcggcttcaccaccctctcctgctcctccacgggcaacctggccggggcc
gtcggcgccgccgccgcccgggccggactgcgctcctgcgtgttcatcccgcacgacctg
gaacagggcaaggtcgtcatggccgcggtgtacggcggtgagctggtcggcatcgagggc
aactacgacgacgtcaaccgcttctgctccgagctcatcggcgacccgctgggcgagggc
tggggcttcgtcaacgtcaacctccgcccgtactacggcgagggctccaagacgctggcg
tacgagatctgcgagcagctcggctggcggctgcccgaccagatcgtcatcccgatcgcg
tccggctcccagctcacgaagatcgacaaggggctccaggagctgatcaagctcggcctg
gtcgaggacaagccgtacaagatcttcggcgcccaggccgagggctgctccccggtctcc
gccgcgttcaaggccggtcacgacgtcgtacggccccagaagccgaacaccatcgccaag
tcgctggccatcggcaacccggccgacggcccctacgtcctggacatcgcccgccgcacc
ggcggcgcggtggaggacgtgaccgacgagcaggtcgtcgacgcgatcaagctgctggcg
cgcaccgagggcatcttcggcgagacggcgggcggcgtgacgctcggcgtgacgaagaag
ctgatcgaggccggtgtcatcgacccgacgctcaccaccgtcgtcgtcaacaccggcgac
ggcctgaagacgctcgacgcggtctccgcgacctcgcaggccacggcgaccatcaagccg
agcctggaggcgttccgcgccgcgggcctcggcaccgcctga

DBGET integrated database retrieval system