KEGG   Streptomyces griseus: SGR_3228Help
Entry
SGR_3228          CDS       T00691                                 

Definition
(GenBank) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sgr  Streptomyces griseus
Pathway
sgr00260  Glycine, serine and threonine metabolism
sgr00750  Vitamin B6 metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01230  Biosynthesis of amino acids
Module
sgr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGR_3228
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SGR_3228
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SGR_3228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAG20057
Kitasato: SGR3228
UniProt: B1VL29
Position
complement(3748910..3750211)
Genome map
AA seq 433 aa AA seqDB search
MAVQTVAGSTASSTPAVDLGPAAALSCRECGERFELGPLFACASCFGPLEVAYDLPTGSP
EELRKRIEAGPDNIWRYAPLLPVPADVAEKPNINPGFTKLVKADNLARELGVTGGLYVKD
DSGNPTHSFKDRVVAIAVEAARAFGFTTLSCSSTGNLAGAVGAAAARAGLRSCVFIPHDL
EQGKVVMAAVYGGELVGIEGNYDDVNRFCSELIGDPLGEGWGFVNVNLRPYYGEGSKTLA
YEICEQLGWRLPDQIVIPIASGSQLTKIDKGLQELIKLGLVEDKPYKIFGAQAEGCSPVS
AAFKAGHDVVRPQKPNTIAKSLAIGNPADGPYVLDIARRTGGAVEDVTDEQVVDAIKLLA
RTEGIFGETAGGVTLGVTKKLIEAGVIDPTLTTVVVNTGDGLKTLDAVSATSQATATIKP
SLEAFRAAGLGTA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcagaccgttgcaggcagcaccgcttcgtccaccccggccgtcgacctcggc
cccgccgcggcgctttcctgccgcgagtgcggcgagcgtttcgagctcggcccccttttc
gcctgtgcgtcctgtttcgggcccctcgaagtggcctacgacctgcccaccggctcgccc
gaggagctgcgcaagcgcatcgaggccggcccggacaacatctggcgctacgccccgctc
ctgccggtgcccgcggacgtcgcggagaagcccaacatcaaccccggcttcaccaagctc
gtcaaggccgacaacctcgcccgcgagctgggcgtcaccggcggcctgtacgtgaaggac
gactccggcaacccgacgcactccttcaaggaccgcgtcgtcgccatcgccgtcgaggcc
gcccgcgccttcggcttcaccaccctctcctgctcctccacgggcaacctggccggggcc
gtcggcgccgccgccgcccgggccggactgcgctcctgcgtgttcatcccgcacgacctg
gaacagggcaaggtcgtcatggccgcggtgtacggcggtgagctggtcggcatcgagggc
aactacgacgacgtcaaccgcttctgctccgagctcatcggcgacccgctgggcgagggc
tggggcttcgtcaacgtcaacctccgcccgtactacggcgagggctccaagacgctggcg
tacgagatctgcgagcagctcggctggcggctgcccgaccagatcgtcatcccgatcgcg
tccggctcccagctcacgaagatcgacaaggggctccaggagctgatcaagctcggcctg
gtcgaggacaagccgtacaagatcttcggcgcccaggccgagggctgctccccggtctcc
gccgcgttcaaggccggtcacgacgtcgtacggccccagaagccgaacaccatcgccaag
tcgctggccatcggcaacccggccgacggcccctacgtcctggacatcgcccgccgcacc
ggcggcgcggtggaggacgtgaccgacgagcaggtcgtcgacgcgatcaagctgctggcg
cgcaccgagggcatcttcggcgagacggcgggcggcgtgacgctcggcgtgacgaagaag
ctgatcgaggccggtgtcatcgacccgacgctcaccaccgtcgtcgtcaacaccggcgac
ggcctgaagacgctcgacgcggtctccgcgacctcgcaggccacggcgaccatcaagccg
agcctggaggcgttccgcgccgcgggcctcggcaccgcctga

DBGET integrated database retrieval system