KEGG   Streptomyces griseus: SGR_3326Help
Entry
SGR_3326          CDS       T00691                                 

Definition
(GenBank) putative acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sgr  Streptomyces griseus
Pathway
sgr00010  Glycolysis / Gluconeogenesis
sgr00620  Pyruvate metabolism
sgr00640  Propanoate metabolism
sgr00680  Methane metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01130  Biosynthesis of antibiotics
sgr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_3326
   00620 Pyruvate metabolism
    SGR_3326
   00640 Propanoate metabolism
    SGR_3326
  Energy metabolism
   00680 Methane metabolism
    SGR_3326
Enzymes [BR:sgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SGR_3326
Lipid biosynthesis proteins [BR:sgr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SGR_3326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N BAT
Motif
Other DBs
NCBI-ProteinID: BAG20155
Kitasato: SGR3326
UniProt: B1VM45
Position
3906791..3908746
Genome map
AA seq 651 aa AA seqDB search
MSNESLANLLREERKFAPPAELAANANVTAEAYEQAEADRLGFWAEQARRLTWDTEPTET
LDWSNPPFAKWFADGKLNVAYNCVDRHVEAGNGDRVAIHFEGEPGDSRAITYAELKDEVS
RAANALTELGVGKGDRVAVYLPMIPEAAIAMLACARIGAAHSVVFGGFSADAIAARIKDA
DAKVVITADGGYRRGKPSALKPAVDDAVSRFENVEHVLVVRRTGQDTAWTEGRDVWWHEI
TARQSAEHTPEAFEAEQPLFILYTSGTTGKPKGILHTSGGYLTQASYTHHAVFDLKPETD
VYWCTADIGWVTGHSYIVYGPLANGATQVMYEGTPDTPHQGRFWEIVQKYGVTILYTAPT
AIRTFMKWGDDIPAKFDLSSLRVLGSVGEPINPEAWMWYRKNIGADKCPIVDTWWQTETG
AMMIAPLPGVTETKPGSAQRALPGIAATVVDDDANEVPNGGGGYLVLTEPWPSMLRTIWG
DDQRFIDTYWSRFEGKYFAGDGAKKDEDGDIWLLGRVDDVMLVSGHNISTTEVESALVSH
PSVAEAAVVGANDETTGQAIVAFVILRGSATASDELVAELRNHVGATLGPIAKPKRVLPV
AELPKTRSGKIMRRLLRDVAENRELGDVTTLTDSSVMDLITTQLPSSSSED
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacgagagcctggccaacctgcttcgggaagagcggaaattcgctccgcctgcc
gagctggccgccaacgccaacgtcaccgcagaggcgtacgagcaggccgaggcggaccgg
ctgggcttctgggccgagcaggcccgccgcctgacgtgggacaccgagccgaccgagacc
ctcgactggagcaacccgcccttcgcgaagtggttcgcggacggcaagctgaacgtcgcg
tacaactgcgtggaccgccacgtcgaggcgggcaacggcgaccgggtcgccatccacttc
gagggcgagccgggcgacagccgggccatcacctacgcggagctgaaggacgaggtctcc
cgcgccgccaacgcgctgaccgaactgggcgtcggcaagggcgaccgggtcgccgtctac
ctgccgatgatccccgaggccgcgatcgcgatgctggcctgcgcccgcatcggcgccgcg
cactccgtggtcttcggcggcttctcggccgacgccatcgccgcccgcatcaaggacgcg
gacgccaaggtagtcatcaccgccgacggcggctaccgccgcggcaagccgtccgcgctc
aagcccgccgtcgacgacgccgtctcgcgcttcgagaacgtcgagcacgtcctcgtcgtc
cgccgcaccggccaggacaccgcgtggaccgagggccgcgacgtctggtggcacgagatc
accgcccggcagtccgccgagcacacccccgaggccttcgaggccgagcagccgctgttc
atcctctacacctcgggcaccacgggtaagccgaaggggatcctgcacacctccggcggc
tacctcacccaggcctcgtacacgcaccacgcggtcttcgacctcaagccggagaccgac
gtctactggtgcaccgccgacatcggctgggtgaccgggcactcgtacatcgtgtacggg
ccgctggccaacggcgcgacgcaggtcatgtacgagggcaccccggacaccccgcaccag
ggccggttctgggagatcgtgcagaagtacggcgtcacgatcctctacaccgcccccacg
gcgatccgtacgttcatgaagtggggcgacgacatccccgcgaaattcgacctgagcagc
ctccgcgtcctgggttcggtcggtgagccgatcaaccccgaggcgtggatgtggtaccgg
aagaacatcggcgccgacaagtgccccatcgtggacacctggtggcagaccgagaccggc
gcgatgatgatcgcgccgctgcccggcgtgacggagacgaagccgggaagcgcccagcgc
gcgctgccgggcatcgccgccaccgtcgtggacgacgacgccaacgaggtgccgaacggc
gggggcggctacctcgtcctcaccgagccgtggccctccatgctccgcaccatctggggc
gacgaccagcggttcatcgacacctactggtcgcgtttcgagggcaagtacttcgcgggc
gacggggcgaagaaggacgaggacggcgacatctggctgctgggccgggtcgacgacgtc
atgctcgtctcggggcacaacatctccaccaccgaggtcgagtccgccctcgtctcccac
ccgtcggtcgccgaggcggccgtggtcggggcgaacgacgagacgacgggccaggccatc
gtggcgttcgtgatcctgcgcggttcggccaccgcctccgacgagctggtcgcggagctg
cgcaaccacgtcggcgcgaccctcggcccaatcgccaagcccaagcgggtcctcccggtc
gccgagctgcccaagacgcgctccggcaagatcatgcgccgcctgctgcgcgacgtcgcc
gagaaccgcgagctgggcgacgtcaccaccctcacggactcctccgtgatggacctgatc
accacccagctgccgtcctcctcgtccgaggactga

DBGET integrated database retrieval system