KEGG   Streptomyces griseus: SGR_3750Help
Entry
SGR_3750          CDS       T00691                                 

Gene name
bkdC2
Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sgr  Streptomyces griseus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGR_3750 (bkdC2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_3750 (bkdC2)
   00020 Citrate cycle (TCA cycle)
    SGR_3750 (bkdC2)
   00620 Pyruvate metabolism
    SGR_3750 (bkdC2)
Enzymes [BR:sgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SGR_3750 (bkdC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
4376937..4378445
Genome map
AA seq 502 aa AA seqDB search
MARVLEFKLPDLGEGLTEAEIVRWLVEVGDVVAIDQPVVEVETAKAMVEVPCPYGGVVTA
RFGEEGTELPVGAPLLTVAVGAPEGLDPSGASPSSAGSPASGTAAESAATATESAGGSGN
VLVGYGTGAPAARRRRIRPDRPDRTYVRTAVSDTPVSEAPALAPAASGTAPATAATASAA
DEAAPAAVAVAVGAVNGQGPVPVVSPLVRRLARQHDIDLRRLAGSGPDGLILRADVDGAI
RQAEETAATARVAEEPGRTPAAPVSPAAPDAERIPLRGVRGAVADKLSRSRTEIPDATCW
VDADATELMAVRAAMNTATGPSAGPKVSVLALLARICTAALARFPELNSTVDTEAREIVR
LPGVHLGFAAQTDRGLVVPVVRDAHIRNVESIGAEIARLTELARTGKLSPAQLTGGTFTL
NNYGVFGVDGSTPIINHPEAAMLGVGRIMPKPWVHQGELAVRQVVQLSLTFDHRVCDGGT
AGGFLRYVADCVEQPAVLLRTL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggccagggtgctcgaattcaagctgccggacctcggtgaggggctgaccgaggcggag
atcgtccgctggctggtggaggtcggcgacgtcgtcgccatcgaccagcccgtcgtcgag
gtcgagacggccaaggccatggtggaggtgccctgcccctacgggggcgtggtgaccgcg
cggttcggcgaggagggcacggaactccccgtcggcgcaccgctgctgacggtcgccgtc
ggagcgccggaggggctggatccctccggggcgtccccgtcgtccgccgggtcccccgcc
tccggcaccgccgcggagtccgccgccacggccacggagtccgcgggcggctcggggaac
gtcctcgtggggtacgggacgggcgcccccgccgcgaggcgtcggcgcatccggccggac
cgacccgaccggacgtacgtccggaccgcggtgtcggacaccccggtgtccgaggcgccc
gctctcgccccggcggcgtccggtacggctcccgcgaccgctgccacggcgtccgccgcc
gacgaggcggctccggccgccgtggctgtcgccgtgggcgcggtgaacgggcaggggccc
gtgccggtggtctctccgctggtacgacggctggcccggcagcacgacatcgatctgcgg
cggctggcgggttcgggccccgacgggctgatcctgcgcgccgacgtcgacggcgcgatc
cgacaggcggaggagaccgcggcgacggcacgggtggccgaggaaccgggccgcacgccc
gcagctcccgtgtccccggccgccccggacgccgagcggattccgctgcgcggagtgcgc
ggagcggtcgccgacaagctgtcgcggagccggaccgagatcccggacgccacctgctgg
gtcgacgccgacgccaccgagctgatggcggtcagagccgcgatgaacaccgcgacgggc
ccgtccgccgggccgaaggtgtcggtgctggccctgctggcgaggatctgcacggctgcc
ctggcccggttccccgagctcaactccaccgtggacaccgaggcccgggagatcgtccgg
ctgcccggcgtgcacctcgggttcgctgcccagaccgaccggggcctcgtcgttccggtc
gtccgggacgcgcacatccgcaatgtcgagtccatcggggccgagatcgcccggctgacc
gagctggcgcggaccgggaagctgagcccggcccagctgaccggaggcaccttcacgctg
aacaactacggcgtgttcggggtcgacggttcgacgccgatcatcaaccaccccgaagcg
gcgatgctcggcgtcggccggatcatgcccaagccgtgggtgcaccagggcgaactggcc
gtacgtcaggtcgtccagctgtccctcaccttcgaccaccgggtgtgcgacggcgggacc
gccggcggcttcctccggtacgtggcggactgcgtggagcagccggcggtgctgctgcgc
accctgtag

DBGET integrated database retrieval system