KEGG   Streptomyces griseus: SGR_3767Help
Entry
SGR_3767          CDS       T00691                                 

Gene name
bkdC1
Definition
(GenBank) putative dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sgr  Streptomyces griseus
Pathway
sgr00010  Glycolysis / Gluconeogenesis
sgr00020  Citrate cycle (TCA cycle)
sgr00620  Pyruvate metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01130  Biosynthesis of antibiotics
sgr01200  Carbon metabolism
Module
sgr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_3767 (bkdC1)
   00020 Citrate cycle (TCA cycle)
    SGR_3767 (bkdC1)
   00620 Pyruvate metabolism
    SGR_3767 (bkdC1)
Enzymes [BR:sgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SGR_3767 (bkdC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: BAG20596
Kitasato: SGR3767
UniProt: B1VQU5
Position
4398228..4399670
Genome map
AA seq 480 aa AA seqDB search
MTTMTETSARFREFKMPDVGEGLTEAEILKWFVQPGDTVTDGQVVCEVETAKAAVELPIP
FDGVVHELRFPEGTTVDVGQVIIAIDVAPGSGDAPAPAAAPAQEPVETPEAEAEPKGRTP
VLVGYGVAETSTKRRPRKGASAAPEAAAVAAAVQAELNGHGAQAPAAVPAQAGAPEGGRP
LAKPPVRKLAKDLGIDLATVVPTGKDGIITREDVHAAAAPASTAPATAPAPAQTAPEAPA
AVVGSDSARETRIPVKGVRKAIAQAMVGSAFTAPHVTEFVTVDVTRTMKLVAELKEDKDM
AGVRVNPLLIIAKALLVAIKRNPEVNAAWDEANQEIVQKHYVNLGIAAATPRGLIVPNIK
DAHAQTLPQLAASLGELVSTARDGRTSPAAMAGGTVTITNVGVFGVDTGTPILNPGESAI
LAVGAIKLQPWVHKGKVKPRQVTTLALSFDHRLVDGELGSKVLADVAAILEQPKRLITWA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgatgaccgaaacgtccgctcgtttccgtgagttcaagatgcccgacgtgggc
gagggactgaccgaggccgagatcctcaagtggttcgtccagcccggtgacaccgtcacc
gacggccaggtcgtgtgcgaggtcgagaccgcgaaggcggccgtcgagctgccgatcccg
ttcgacggggtggtgcacgagctgcgcttccccgagggcacgaccgtcgacgtcggccag
gtgatcatcgcgatcgacgtggccccgggcagcggcgacgcgcccgccccggccgccgct
ccggcccaggagccggtggagacgccggaggccgaggccgagccgaagggccgcacgccg
gtcctggtgggctacggcgtcgccgagacgtccaccaagcgccgcccgcgcaagggggcg
tccgccgccccggaggccgccgccgtcgcggcggcggtgcaggccgagctgaacgggcac
ggggcgcaggccccggcggccgttcccgcgcaggccggtgcgccggagggaggccgtccg
ctggccaagcccccggtccgcaagctcgccaaggacctgggcatcgacctggcgactgtg
gtgccgaccggcaaggacggcatcatcacccgcgaggacgtccacgccgcggcggcgccg
gcctccacggctccggcgaccgccccggcccccgcgcagacggcccccgaggccccggcg
gccgtcgtgggctccgactccgcccgcgagacccgcatcccggtcaagggcgtccgcaag
gccatcgcgcaggcgatggtgggcagcgcgttcaccgcgccgcacgtcaccgagttcgtc
acggtcgacgtgacgcgcacgatgaagctcgtggccgagctcaaggaggacaaggacatg
gcgggggtgcgggtcaacccgctcctcatcatcgccaaggccctcctcgtggcgatcaag
cggaaccccgaggtcaacgccgcctgggacgaggccaaccaggagatcgtgcagaagcac
tacgtcaacctgggcatcgcggcggccaccccgcgcggtctgatcgtgccgaacatcaag
gacgcgcacgcccagacgctgccgcagctcgcggcgtccctgggcgagctggtcagcacc
gcccgggacggcaggacgtccccggcggcgatggcgggcggcacggtgaccatcaccaac
gtcggcgtcttcggcgtcgacaccggtaccccgatcctcaacccgggcgagtccgcgatc
ctcgcggtcggcgcgatcaagctccagccgtgggtccacaagggcaaggtgaagccgcgt
caggtcaccacgctggccctgtcgttcgaccaccgcctggtcgacggcgagctgggctcc
aaggtgctggccgatgtggcggcgatcctggaacagccgaagcgcctgatcacctgggcg
tag

DBGET integrated database retrieval system