KEGG   Streptomyces griseus: SGR_3767Help
Entry
SGR_3767          CDS       T00691                                 

Gene name
bkdC1
Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sgr  Streptomyces griseus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGR_3767 (bkdC1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_3767 (bkdC1)
   00020 Citrate cycle (TCA cycle)
    SGR_3767 (bkdC1)
   00620 Pyruvate metabolism
    SGR_3767 (bkdC1)
Enzymes [BR:sgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SGR_3767 (bkdC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
4398228..4399670
Genome map
AA seq 480 aa AA seqDB search
MTTMTETSARFREFKMPDVGEGLTEAEILKWFVQPGDTVTDGQVVCEVETAKAAVELPIP
FDGVVHELRFPEGTTVDVGQVIIAIDVAPGSGDAPAPAAAPAQEPVETPEAEAEPKGRTP
VLVGYGVAETSTKRRPRKGASAAPEAAAVAAAVQAELNGHGAQAPAAVPAQAGAPEGGRP
LAKPPVRKLAKDLGIDLATVVPTGKDGIITREDVHAAAAPASTAPATAPAPAQTAPEAPA
AVVGSDSARETRIPVKGVRKAIAQAMVGSAFTAPHVTEFVTVDVTRTMKLVAELKEDKDM
AGVRVNPLLIIAKALLVAIKRNPEVNAAWDEANQEIVQKHYVNLGIAAATPRGLIVPNIK
DAHAQTLPQLAASLGELVSTARDGRTSPAAMAGGTVTITNVGVFGVDTGTPILNPGESAI
LAVGAIKLQPWVHKGKVKPRQVTTLALSFDHRLVDGELGSKVLADVAAILEQPKRLITWA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgatgaccgaaacgtccgctcgtttccgtgagttcaagatgcccgacgtgggc
gagggactgaccgaggccgagatcctcaagtggttcgtccagcccggtgacaccgtcacc
gacggccaggtcgtgtgcgaggtcgagaccgcgaaggcggccgtcgagctgccgatcccg
ttcgacggggtggtgcacgagctgcgcttccccgagggcacgaccgtcgacgtcggccag
gtgatcatcgcgatcgacgtggccccgggcagcggcgacgcgcccgccccggccgccgct
ccggcccaggagccggtggagacgccggaggccgaggccgagccgaagggccgcacgccg
gtcctggtgggctacggcgtcgccgagacgtccaccaagcgccgcccgcgcaagggggcg
tccgccgccccggaggccgccgccgtcgcggcggcggtgcaggccgagctgaacgggcac
ggggcgcaggccccggcggccgttcccgcgcaggccggtgcgccggagggaggccgtccg
ctggccaagcccccggtccgcaagctcgccaaggacctgggcatcgacctggcgactgtg
gtgccgaccggcaaggacggcatcatcacccgcgaggacgtccacgccgcggcggcgccg
gcctccacggctccggcgaccgccccggcccccgcgcagacggcccccgaggccccggcg
gccgtcgtgggctccgactccgcccgcgagacccgcatcccggtcaagggcgtccgcaag
gccatcgcgcaggcgatggtgggcagcgcgttcaccgcgccgcacgtcaccgagttcgtc
acggtcgacgtgacgcgcacgatgaagctcgtggccgagctcaaggaggacaaggacatg
gcgggggtgcgggtcaacccgctcctcatcatcgccaaggccctcctcgtggcgatcaag
cggaaccccgaggtcaacgccgcctgggacgaggccaaccaggagatcgtgcagaagcac
tacgtcaacctgggcatcgcggcggccaccccgcgcggtctgatcgtgccgaacatcaag
gacgcgcacgcccagacgctgccgcagctcgcggcgtccctgggcgagctggtcagcacc
gcccgggacggcaggacgtccccggcggcgatggcgggcggcacggtgaccatcaccaac
gtcggcgtcttcggcgtcgacaccggtaccccgatcctcaacccgggcgagtccgcgatc
ctcgcggtcggcgcgatcaagctccagccgtgggtccacaagggcaaggtgaagccgcgt
caggtcaccacgctggccctgtcgttcgaccaccgcctggtcgacggcgagctgggctcc
aaggtgctggccgatgtggcggcgatcctggaacagccgaagcgcctgatcacctgggcg
tag

DBGET integrated database retrieval system