KEGG   Streptomyces griseus: SGR_3849Help
Entry
SGR_3849          CDS       T00691                                 

Definition
O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sgr  Streptomyces griseus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(4511018..4512253)
Genome map
AA seq 411 aa AA seqDB search
MTNTTVEPDEATRLRNKVVDELRAGGDISSSEIEAVMRKVPRHAFIPDTPLDKAYDTYAA
VITKTDEHGVQLSSVSAPQIQAMMLEQAQVKPGMRVLEIGSGGLNAAYLAELVGEHGEVV
TVDIDPVVTERAHRLLNEHGYDRVRVLTADAAEPIPELGEVDVVMVTAGAWDIAPAWTAQ
LKQGGRLVVPLRMRGLTRSVAFTQIPGEHGPYLESVSALICGFVPMQGSTAHREELLLVN
GTPEIGLKFDDGLPADPHRLDNVVTYPRHELWTGVVIGLSELIDTLQMAMAISLPGFCTM
AVDEDLDTGLVAPVNRRFALAAVEDDTFAYLVTRRTEDNKHIEYGVHALGPNAEQFADQV
ADVLRDWEASRRGGPSPVIRVYPANTSDDQIPADRVIDKVHSRVSLSWPSA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacacgaccgtcgagcccgacgaagcgacccgtctccggaacaaggtggtggac
gagctgcgcgcaggcggcgacatctcctcctcggagatcgaagccgtcatgcgcaaggtg
cctcggcacgcgttcattcccgacaccccgctggacaaggcgtacgacacgtacgcggca
gtgatcaccaagacggacgagcacggtgtgcagctcagctccgtctccgccccgcagatc
caggcgatgatgctggagcaggcccaggtgaagcccggcatgcgcgtgttggagatcggt
tcgggcgggctgaacgccgcctacctcgccgagctcgtaggcgagcacggcgaggtcgtc
accgtggacatcgatcccgtagtcaccgagcgggcgcaccggctcctgaacgagcacggc
tacgaccgggtacgcgtccttaccgccgacgccgccgagcccattccggagctcggcgag
gtcgacgtcgtcatggtgaccgccggagcctgggacatcgctccggcgtggaccgcgcag
ctcaagcagggcggtcggcttgtggtgccgctgcggatgcgtggcctgacccggtcggtc
gccttcacccagatcccgggcgaacacggtccctacctggagagcgtgtcggcgctcatc
tgcggcttcgtcccgatgcagggctcgacggcccaccgggaagaacttcttctcgtcaac
ggcacaccggagatcgggctgaagttcgacgacggactaccggccgacccacaccgtctg
gacaacgtggtcacgtacccgcgccacgagctgtggacaggcgtcgtcatcggcctctcg
gaactcatcgacaccctccagatggccatggccatcagcctgcccggcttctgcacgatg
gccgtcgacgaggacctggacacgggcctggtcgcccccgtgaacaggcggttcgccctc
gccgccgtcgaggacgacaccttcgcctacctcgtcacccgccgcaccgaggacaacaag
cacatcgagtacggcgtgcacgccctcggcccgaacgcggagcagttcgccgaccaggtc
gccgacgtgcttcgcgactgggaggccagccggcgcgggggccccagtccggtcatccgg
gtctatccggccaacacctctgatgaccaaatcccggccgaccgggtcatcgacaaggtg
cacagccgggtctcgctctcctggccctcggcgtaa

DBGET integrated database retrieval system