KEGG   Streptomyces griseus: SGR_4056Help
Entry
SGR_4056          CDS       T00691                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sgr  Streptomyces griseus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGR_4056
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_4056
   00052 Galactose metabolism
    SGR_4056
   00500 Starch and sucrose metabolism
    SGR_4056
   00520 Amino sugar and nucleotide sugar metabolism
    SGR_4056
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGR_4056
   00524 Butirosin and neomycin biosynthesis
    SGR_4056
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SGR_4056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(4746367..4747257)
Genome map
AA seq 296 aa AA seqDB search
MKAALVGTDGTLLHEARRATGRERGADAVVETILAFAAELRAHGEEHLGESAVAAGVAVP
GIVDAEKGIAVYAANLGWRDVPLRALLAERIGVPVALGHDVRTGGLAEGRIGAGRGTDRF
LFVPLGTGIAGAIGIAGAIEAGAHGDAGEIGHIVVRPDGPDCSCGQRGCLETLASAAAVT
RAWAAASGDPEADAADCAKAVESGDPAAIRVWQDAIDALAAGLVTALTLLDPGTLIIGGG
LAEAGETLFTPLRAAVEERITFQKLPRIVPAALGDTAGCLGAGLLAWDLLSTEVSA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgcactggtcgggaccgacggcaccctcctccacgaggcgcggcgggccacc
ggccgcgagcgcggcgccgacgcggtcgtcgagaccatcctcgcgttcgcggcggagctg
cgcgcccacggcgaggagcacctcggcgagagcgccgtcgccgccggggtcgccgtgccc
ggcatcgtcgacgccgagaagggcatcgcggtgtacgccgcgaacctgggctggcgcgac
gtaccgctgcgcgcgctactggccgagcggatcggcgtccccgtcgccctcggccacgac
gtccgcaccggcgggctcgccgagggccggatcggggccggacggggcacggaccgcttc
ctgttcgtcccgctgggcaccggcatcgccggggccatcggcatcgcgggcgccatcgag
gcgggcgcccacggggacgcgggcgagatcggccacatcgtggtccgcccggacggcccc
gactgcagttgcggccagcgcggctgtctggagacgctggcctcggccgccgcggtgacc
cgcgcctgggccgccgcctccggcgaccccgaggcggacgccgcggactgcgcgaaggcc
gtcgaatccggcgacccggcggcgatccgggtctggcaggacgcgatcgacgcgctcgcc
gccggcctcgtcaccgcgctcaccctcctcgaccccggcacgctcatcatcggtggcggt
ctcgccgaagccggggaaaccttgttcacaccactgcgtgcggccgtcgaggaacggatc
acgttccagaagctgccccgcatcgtcccggcggccctcggggacaccgccggatgcctg
ggcgcggggctgctcgcctgggatctactctccacggaggtttccgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system