KEGG   Streptomyces griseus: SGR_4091Help
Entry
SGR_4091          CDS       T00691                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydr opteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sgr  Streptomyces griseus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sgr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(4784721..4785332)
Genome map
AA seq 203 aa AA seqDB search
MTAFSTAGQSDPTVQPVPTAVVRQVDAADVTLSNPKMAVISLGSNLGNRLETLQGAVDAL
EDTPGLRVKAVSPVYETEPWGVEADSQPSYFNAVILVKTTLPPASLLERGQAVEEAFDRV
REERWGPRTIDVDIVAYADVLSDDPVLTLPHPRAKERAFVLAPWHDIDPEAQLPGAGPVA
QLLAEVGRDGVLPRADLELRLPE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgactgcattttccaccgcagggcagagcgacccgaccgtacagccggttccgaccgcc
gtcgtccggcaggtggacgcggccgacgtcacgctctccaaccccaagatggccgtgatc
tccctcggctccaacctgggcaaccggctggagaccctccagggggccgtcgacgccctg
gaggacaccccgggcctccgggtcaaggccgtctccccggtgtacgagacggagccctgg
ggcgtcgaggcggactcccagccctcgtacttcaacgccgtcatcctcgtgaagacgacc
ctgccccccgcctccctgctggagcgcggccaggccgtcgaggaggccttcgaccgggtc
cgcgaggagcgctggggcccgcgcaccatcgacgtcgacatcgtggcgtacgccgacgtc
ctctccgacgacccggtgctcacgctcccccacccgcgcgccaaggagcgggccttcgtc
ctcgccccctggcacgacatcgaccccgaggcccaactgcccggcgccggcccggtggcc
cagctcctcgccgaggtcggccgcgacggcgtcctgccccgcgccgacctggaactgcgc
ctgccggagtaa

DBGET integrated database retrieval system