KEGG   Streptomyces griseus: SGR_4158Help
Entry
SGR_4158          CDS       T00691                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sgr  Streptomyces griseus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SGR_4158
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SGR_4158
Exosome [BR:sgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SGR_4158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
4863851..4864858
Genome map
AA seq 335 aa AA seqDB search
MTAYGNFPGSRPRRLRTTPAMRRMVAETRLDPANLILPAFVREGIDAPVAIAAMPGVYQH
TLDTLRKAAVEAVSAGVSGIMVFGVPEDEKKDARGTAGTDPDGILQVALRAVREEVGDDL
VIMSDLCLDEYTDHGHCGVLTADGRVDNDATLERYAEMAQVQADAGAHVVGPSGMMDGQV
GVVRDALDQTGHEDVSILAYAVKYSSAFYGPFREAVGSSLTGDRKTYQQDPANARESLRE
LALDLAEGADMVMVKPAGPYLDILAKVAESVDVPVAAYQISGEYAMIEAAAERGWIDRDK
AILESLTGIRRAGARMILTYWATEAAQWLGRDARR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgtacggaaacttccccggctcccgcccccggcggctgcggacgaccccggcg
atgcggcggatggtcgccgagacacggctcgaccccgcgaacctgatcctgcccgcgttc
gtgcgggagggtatcgacgccccggtcgccatcgcggcgatgcccggtgtgtaccagcac
accctggacaccctgcggaaggcggccgtcgaggcggtctcggccggggtctcggggatc
atggtcttcggagtgccggaggacgagaagaaggacgcccggggcacggcgggcacggac
ccggacgggatcctccaggttgccctgcgcgcggtccgcgaggaggtcggcgacgacctc
gtcatcatgtcggacctgtgcctggacgagtacaccgaccacggccactgcggggtcctg
acggccgacggccgggtggacaacgacgcgacgctggagcggtacgcggagatggcccag
gtgcaggcggacgcgggcgcccatgtggtggggcccagcgggatgatggacggccaggtc
ggcgtggtccgggacgccctggaccagacgggccacgaggacgtgtcgatcctcgcctac
gccgtgaagtacagctccgccttctacggcccgttccgcgaggccgtcggctcctcgctg
accggcgaccgcaagacctaccagcaggacccggccaacgcccgcgagtcgctgcgggag
ctggcgctggacctggcggagggcgcggacatggtcatggtgaagcccgccgggccgtat
ctggacatcctcgccaaggtcgcggagtccgtggacgtgccggtcgcggcgtaccagatc
agcggcgagtacgcgatgatcgaggccgccgccgagcggggctggatcgaccgggacaag
gcgatcctggagagcctgaccgggatccggcgggccggggcccggatgatcctcacctac
tgggcgaccgaggcggcccagtggctcgggcgggacgcgcggcgctga

DBGET integrated database retrieval system