KEGG   Streptomyces griseus: SGR_4296Help
Entry
SGR_4296          CDS       T00691                                 

Definition
(GenBank) putative UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sgr  Streptomyces griseus
Pathway
sgr00040  Pentose and glucuronate interconversions
sgr00052  Galactose metabolism
sgr00500  Starch and sucrose metabolism
sgr00520  Amino sugar and nucleotide sugar metabolism
sgr01100  Metabolic pathways
sgr01130  Biosynthesis of antibiotics
Module
sgr_M00362  Nucleotide sugar biosynthesis, prokaryotes
sgr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SGR_4296
   00052 Galactose metabolism
    SGR_4296
   00500 Starch and sucrose metabolism
    SGR_4296
   00520 Amino sugar and nucleotide sugar metabolism
    SGR_4296
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SGR_4296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: BAG21125
Kitasato: SGR4296
UniProt: B1VTN5
Position
5027081..5027983
Genome map
AA seq 300 aa AA seqDB search
MTQSHPRISKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVAAGLSDVLMI
TGRNKRPLEDHFDRNYELESALTRKGDAERLAKVQESSDLATMHYVRQGDPRGLGHAVLC
AAPHVGDQPFAVLLGDDLIDPRDALLARMVEVQEREGGSVIALMEVEPSQVHLYGCAAAD
ATVDGDVVRITDLVEKPDPADAPSNLAIIGRYVLDPAVFDILRHTEPGRGGEIQLTDALQ
LLAADEKIGGPVHGVVFKGRRYDTGDRGDYLRAIVRLACEREDLGPDFRTWLRKYVAEEM
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgactcagtcgcaccccaggatcagcaaggccgtcatcccggcagcaggtctcggcacc
cggttcctgcccgccacgaaggccactcccaaggagatgctgcctgtcgtcgacaagccg
gccatccagtatgtcgtcgaagaggccgtggcggcgggtctctccgacgtactgatgatc
accggccgcaacaagcgtccgctcgaggaccacttcgaccgcaactacgagctggagtcc
gcgctcacccgcaagggcgacgccgaacgcctcgccaaggtccaggagtccagcgacctg
gccaccatgcactacgtgcggcagggcgacccccgcggcctcggtcacgccgtgctgtgc
gccgccccgcacgtgggcgaccagcccttcgcggtgctcctcggcgacgacctgatcgac
ccgcgcgacgcgctgctggcccggatggtcgaggtccaggagcgtgagggcggcagcgtc
atcgcactcatggaggtcgagccctcgcaggtccacctctacggctgcgccgccgcggac
gccaccgtcgacggcgacgtggtccgcatcaccgacctggtcgagaagccggacccggcc
gacgcccccagcaacctcgccatcatcggccggtacgtcctggaccccgcggtcttcgac
atactgcgacacaccgagccgggccgcggcggcgagatccagctcaccgacgcgctccag
ctgctcgccgcggacgagaagatcggcggccccgtgcacggcgtcgtcttcaagggccgc
cgctatgacaccggcgaccgcggcgactatctgcgcgccattgtcagactggcgtgcgaa
cgtgaggacctgggaccggacttccggacctggctgcgcaagtacgtcgctgaggagatg
taa

DBGET integrated database retrieval system