KEGG   Streptomyces griseus: SGR_4357Help
Entry
SGR_4357          CDS       T00691                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sgr  Streptomyces griseus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SGR_4357
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SGR_4357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
5089865..5090773
Genome map
AA seq 302 aa AA seqDB search
MSTVRTGVTVRVPAKVNVQLAVGAARPDGFHDLANVFLAVGLYDEVTAAPADELRVTCSG
PDAGQVPLDRTNLAARAALALAERYGIDPAVHLHIAKDIPVAGGMAGGSADGAAALVACD
ALWGTGASRDELLAICAELGSDVPFSLVGGAALGTGRGEKLTPIEVGGTFHWVFAVADGG
LSTPAVYGEFDRLTAGTEVPEPTASPALLAALRSGDPGALAGALSNDLQPAALSLRPSLA
ETLAAGTEAGAPAALVSGSGPTTAFLVPDAETAEKVAAALLTSGTCRNARVAASPAPGAH
VI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgtccgtacgggcgtcaccgtccgcgtccccgccaaggtcaacgtccagctc
gccgtgggcgccgcccgccccgacggcttccacgacctggccaacgtcttcctcgccgtc
ggcctgtacgacgaggtcaccgcggcccccgccgacgagctgcgcgtcacctgctcgggc
ccggacgccggccaggtgcctctggaccgtacgaatctcgccgcccgcgccgccctcgcg
ctggccgagcggtacggcatcgaccccgccgtccacctccacatcgccaaggacatcccg
gtcgcgggcggcatggcgggcggcagcgccgacggggccgccgccctggtcgcctgcgac
gccctgtgggggaccggcgcgagccgcgacgagctgttggccatctgcgccgaactgggc
agcgacgtgccgttcagcctggtgggcggggccgcgctcggtacgggacgcggcgagaag
ctgaccccgatcgaggtcggcggcacgttccactgggtcttcgcggtggcggacgggggc
ctctccacgcccgccgtctacggagagttcgaccgcctcaccgccggcaccgaggtcccc
gaaccgaccgcgtcccccgccctcctggccgccctgcgctccggcgaccccggcgcactc
gcgggagccctgagcaacgacctccagcccgccgcgctctccctgcgcccgtccctcgcg
gagacgctggcggcgggcacggaggccggggcgccggcggcgctggtctccggttccggg
ccgacgacggcgttcctcgtcccggacgcggagacggccgagaaggtggcggcggcgctg
ctgacctccgggacctgccgcaacgcgcgcgtggcggcctcgcccgcgccgggcgcgcac
gtgatctga

DBGET integrated database retrieval system