KEGG   Streptomyces griseus: SGR_4379Help
Entry
SGR_4379          CDS       T00691                                 

Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sgr  Streptomyces griseus
Pathway
sgr00620  Pyruvate metabolism
sgr00680  Methane metabolism
sgr01100  Metabolic pathways
sgr01120  Microbial metabolism in diverse environments
sgr01200  Carbon metabolism
Module
sgr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SGR_4379
  Energy metabolism
   00680 Methane metabolism
    SGR_4379
Enzymes [BR:sgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SGR_4379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF615
Motif
Other DBs
NCBI-ProteinID: BAG21208
Kitasato: SGR4379
UniProt: B1VUI2
Position
5115402..5118131
Genome map
AA seq 909 aa AA seqDB search
MSSADQTPAASPALRADIRRLGDLLGETLVRQEGQELLDLVERVRALTRTDGEAAAELLG
DTDLETAARLVRAFSTYFHLANVTEQVHRAHEMRDRRAAEGGLLARTADRLKDADPEHLR
ETVKNLNVRPVFTAHPTEAARRSVLNKLRRIAALLETPAIEADRRRLDLRLAENIDLIWQ
TDELRVVRPEPADEARNAIYYLDELHTGAVGDVLEDLAAELERVGVELPAGTRPLTFGTW
IGGDRDGNPNVTPAVTWDVLILQHEHGITDALEMIDHLRGLLSNSIRYAGATEELLTSLQ
ADLERLPGISPRYKRLNAEEPYRLKATCIRQKLVNTRERLAEGTPHRPGCDYLGTAELIA
DLELIQTSLRAHKGGLFADGRMDRTIRTLGAFGLQLATMDVREHADAHHHALGQLFDRLG
EESWRYADMPRDYRQKLLAKELRSRRPLAPTPAPLDAAGEKTLGVFHTIKQAFERFGPEV
IESYIISMCQGADDVFAAAVLAREAGLVDLHAGWAKIGIVPLLETTDELKAADVILDEML
ADPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLFH
GRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPALARENLELTVAATL
QASALHTAPRQSDEALARWDAAMDTVSDAAHSAYRKLVEDPDLPAYFLASTPVDQLADLH
LGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWYGVGSGLKALREAGLDTVLDEMH
EHWHFFRNFLSNVEMTLAKTDLRIARHYVDTLVPDELKHVFDAIEAEHALTVREVLKVTG
STELLGTSPVLQQTFGIRDAYLDPISYLQVSLLARQRQAAERGEEPDPLLARALLLTVNG
VAAGLRNTG
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccagacccctgccgccagccccgcgctgcgcgccgacatccgccgc
ctcggcgacctcctcggcgaaaccctcgtacgccaggagggccaggagctcctcgacctc
gtcgagcgggtccgcgccctgacccgcaccgacggcgaagccgccgccgaactcctcggc
gacacggacctggagaccgccgcccggctcgtgcgcgccttctccacctacttccacctc
gccaacgtcaccgagcaggtccaccgcgcccacgagatgcgcgaccgccgcgcggccgag
ggcggcctgctggcccgcaccgcggaccggctcaaggacgccgaccccgagcacctccgc
gagacggtcaagaacctcaacgtccgccccgtcttcaccgcccaccccaccgaggcggcc
cgccgctcggtcctcaacaagctccggcgcatcgcggccctcctggagaccccggccatc
gaggccgaccgccgccgcctggacctccgcctcgccgagaacatcgacctcatctggcag
accgacgaactccgcgtcgtccgcccggagcccgccgacgaggcccgcaacgccatctac
tacctcgacgaactccacacgggcgccgtcggggacgtcctggaggacctcgccgccgag
ctggaacgcgtcggcgtcgaactgcccgccggcacccgccccctcaccttcggcacctgg
atcggcggcgaccgcgacggcaaccccaacgtgacgcccgccgtcacctgggacgtcctg
atcctccagcacgagcacggcatcaccgacgccctggagatgatcgaccacctccgcggc
ctcctctccaactccatccgctacgccggagccaccgaggaactcctcacctccctccag
gccgatctggaacgcctccccggcatcagcccccgctacaagcggctgaacgccgaggag
ccctaccgcctcaaggccacctgcatccggcagaagctcgtcaacacccgcgagcgcctc
gccgaaggcaccccgcaccgccccggctgcgactacctcggcaccgccgagctcatcgcc
gacctggaactcatccagacctccctgcgcgcgcacaagggcggcctcttcgccgacggc
cggatggaccgcaccatccgcacgctcggcgcgttcggcctccagctcgccaccatggac
gtacgcgaacacgccgacgcccaccaccacgccctcggccagctcttcgaccggctcggc
gaggagtcctggcgctacgccgacatgccccgcgactaccggcagaagctcctcgccaag
gagctgcgctcccgccggccgctcgcccccaccccggccccgctcgacgcggccggcgag
aagaccctcggcgtcttccacaccatcaagcaggccttcgaacgcttcggacccgaagtc
atcgagtcctacatcatctcgatgtgccagggcgccgacgacgtcttcgccgccgcagtc
ctcgcccgcgaggccggactcgtcgacctgcacgccggctgggccaagatcggcatcgtc
ccgctcctggagaccaccgacgagctcaaggccgccgacgtcatcctcgacgagatgctc
gccgacccctcctaccgccgcctcgtctccctgcgcggcgacgtccaggaggtcatgctc
ggctacagcgactcgtccaagttcggcggcatcacgacctcccagtgggagatccaccgc
gcccagcgccgcctccgcgacgtcgcccaccgctacggcgtgcgcctgcgcctcttccac
ggccgcggcggcaccgtcggccgcggcggcggcccctcccacgacgccatcctcgcccag
ccctggggcaccctggagggcgagatcaaggtgaccgagcagggcgaggtcatctccgac
aagtacctcatccccgccctcgcccgcgagaacctggaactgaccgtcgcggccaccctc
caggcctccgccctgcacacggccccccgccagtccgacgaggccctcgcccgctgggac
gcggccatggacaccgtctccgacgcggcccacagcgcctaccgcaagctcgtcgaggac
cccgacctgcccgcgtacttcctcgcctccaccccggtggaccagctcgccgacctgcac
ctgggctcacggccctcccgccgccccggctccggcgtctcgctcgacggcctgcgcgcc
atcccgtgggtcttcggctggacccagtcccgccagatcgtccccggctggtacggcgtc
ggctccggcctcaaggccctgcgcgaggccggactcgacaccgtcctcgacgagatgcac
gagcactggcacttcttccggaacttcctctccaacgtggagatgacgctcgccaagacc
gacctgcgcatcgcccgccactacgtcgacacgctcgtccccgacgagctgaagcacgtc
ttcgacgccatcgaggccgaacacgcgctgaccgtacgggaagtcctcaaggtcaccggt
tccaccgaactgctcggcaccagcccggtgctccagcagaccttcggaatccgcgacgcc
tacctggacccgatctcctacctccaggtctccctgctggcccgccagcgccaggccgcc
gagcgcggcgaggagcccgacccgctgctcgcccgcgccctcctgctcaccgtcaacggc
gtcgcggcgggactccgcaacaccggctga

DBGET integrated database retrieval system