KEGG   Streptomyces griseus: SGR_4500Help
Entry
SGR_4500          CDS       T00691                                 

Definition
F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
sgr  Streptomyces griseus
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:sgr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(5265522..5266787)
Genome map
AA seq 421 aa AA seqDB search
MPEVRAGDDLAKLIAAAEPGLVDGDILLVTSKIVSKAEGRVVRAADREAAIDAETVRVVA
RRGPLRIVENRQGLVMAAAGVDASNTPAGTVLLLPEDSDASARAIRDGLRDALGVRVGVV
VTDTFGRPWRNGLTDVAIGAAGVRVLDDLRGGTDAYGNPLSATVVATADELASAGDLVKG
KAEGLPVAVVRGLAHAVSADAESPGARALVRSAADDMFRLGTSEAIREAVTLRRTVREFT
DDPVDPGAVRRAVAAAVTAPAPHHTTPWRFVLLESAGSRTRLLDAMRDAWIEDLRRDGKS
EESIAKRVRRGDVLRNAPYLAVPCLVMDGSHTYGDERRDAAEREMFVVAAGAGVQNFLVA
LAGERLGSAWVSSTMFCRSVVREVLSLPSSWDPLGAVAVGHPAGAPRERGARDAEAFLTV
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggtgcgggccggtgacgatctcgccaagctgatcgccgcggccgagcccgga
ctggtcgacggggacatcctgctcgtcacctcgaagatcgtttccaaggccgagggccgg
gtcgtccgggccgccgaccgcgaggccgccatcgacgccgagaccgtgcgggtcgtggcc
cggcgcggtccgctgcgcatcgtggagaaccggcagggtctggtcatggccgccgccggg
gtcgacgcgtcgaacacgccggccgggaccgtcctgctgctgccggaggactcggacgcc
tccgcccgggccatccgggacgggctgcgggacgccctcggcgtgcgggtgggcgtcgtc
gtcacggacacgttcgggcggccctggcgcaacgggctgaccgatgtcgcgatcggggcg
gccggagtgcgggtgctggacgatctgcgcggcgggacggacgcgtacggcaatccgctc
agcgccacggtcgtggccacggcggacgagctggcctcggccggggacctggtcaagggc
aaggcggaggggctgccggtcgccgtggtgcgggggctggcgcacgcggtgtccgccgac
gcggaatccccgggcgcgcgtgcgctcgtacggagtgcggccgacgacatgttccgcctc
gggacgtcggaggcgatccgtgaagcggtgacgctgcggcgtacggtgcgcgagttcacc
gacgatccggtggaccccggtgccgtgcggcgggccgtggccgccgcggtgaccgccccg
gcccctcatcacacgacgccgtggcggttcgtgctgctggagtccgccgggtcgcggacc
cggctgctcgacgcgatgcgcgacgcgtggatcgaggacctgcggcgcgacggcaagagc
gaggagtcgatcgccaagcgggtgcggcgcggggacgtcctgcgcaacgcgccgtatctg
gcggtgccgtgcctggtgatggacggctcgcacacgtacggggacgagcggcgcgacgcc
gcggagcgcgagatgttcgtcgtcgcggcgggcgccggcgtgcagaacttcctggtcgcg
ctggcgggtgagcggctggggtcggcgtgggtgtcctcgacgatgttctgccggtccgtg
gtgcgggaggtgctgtccctgccgtcgtcctgggatccgctcggggcggtggctgtcggg
catccggcgggggcgccgcgggagcggggcgctcgggacgcggaggcgtttctcaccgtg
cggtga

DBGET integrated database retrieval system