KEGG   Streptomyces griseus: SGR_4576Help
Entry
SGR_4576          CDS       T00691                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sgr  Streptomyces griseus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SGR_4576
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SGR_4576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
5378199..5379341
Genome map
AA seq 380 aa AA seqDB search
MQDDDTTHGPLAGFTVGVTAARRAEELATLLERRGAAVLHAPALRIVQLADDSELLAATR
ELIGHAPDVAVATTAIGFRGWIEAADGWGVGDALLKTLGGVELLARGPKVKGAVRAAGLT
ETWSPGSESMAEVLDRLLAQGVAGRRIALQLHGEPLPGFVESLTAAGADVVVVPVYRWMP
PRDIAPLDRMLDVTAARGLDAITFTSAPAAASFLGRAETRGLLPEILGALRDDVLVACVG
PVTALPLQARGIDTLQPERFRLGPLIQLMCARLPLAARILPVAGHRVEIRGHAVLVDDEL
RAVPPAGMALLHALARRPGWVVARADLLRVLPGSGTDEHAVETAMARLRSALGVPRLIQT
VVKRGYRLALDPSADTKYDR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgacgacacaacgcacggccccctcgcgggcttcaccgtcggggtgaccgcc
gcccggcgcgccgaggagctcgccaccctcctcgaacgccgcggggccgccgtcctgcac
gcgcccgccctgcggatcgtgcagctcgccgacgacagcgaactcctggccgcgaccagg
gagctgatcggccacgcccccgacgtggcggtcgccaccaccgcgatcggcttccgcggc
tggatcgaggcggccgacggctggggcgtcggcgacgccctgttgaagacgctgggcggg
gtcgaactcctcgcccggggacccaaggtcaagggcgccgtccgggctgccggactgacc
gaaacctggtcgcccgggtccgagtcgatggccgaggtcctcgaccggctcctcgcccag
ggcgtcgccggccgccggatcgccctccagctgcacggcgaaccgctgcccggcttcgtc
gagtccctgacggcggcgggcgccgacgtcgtggtcgtccccgtctaccggtggatgccc
ccgcgggacatcgccccgctcgaccggatgctcgacgtcaccgccgcccggggcctggac
gcgatcaccttcaccagcgcccccgcggccgcctcgttcctgggccgcgcggagacccgc
ggactgctcccggagatcctcggggccctgcgcgacgacgtcctggtcgcctgcgtcgga
ccggtcaccgccctcccgctccaggcccggggcatcgacaccctccagccggaacgcttc
cggctcggccccctcatccagctgatgtgcgcccggctgccgctcgccgcccgcatcctg
cccgtcgccggccaccgggtcgagatccggggccacgccgtcctcgtcgacgacgagctg
cgcgcggtgccgcccgcgggcatggccctgctgcacgccctggcccgccgccccggctgg
gtggtggcccgcgccgacctgctgcgggtcctgccgggcagcggcaccgacgagcacgcc
gtggagaccgcgatggcccggctgcgctcggcgctgggcgtgccccggctgatccagacg
gtcgtcaagcgcggctaccggctggcgctcgacccgtcggcggacacgaagtacgaccgc
tga

DBGET integrated database retrieval system