KEGG   Streptomyces griseus: SGR_4591Help
Entry
SGR_4591          CDS       T00691                                 

Definition
sugar hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sgr  Streptomyces griseus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sgr00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sgr00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
5393958..5395667
Genome map
AA seq 569 aa AA seqDB search
MTPANSVSPGAVDPAALGLIPAPRTLTAAAAGPYPLGYATPLTAGPGTEGVARWLRSTLG
PATGLPLPAGDGTGTGAGDGSGTGSNGQGIVLALDESLAPEAYRLEVGATAVRITGGTAA
GVFRGAQTLRQLLGPDAFRRAPLAPGRTWEVPPVVVEDEPRFGWRGMMLDVSRHFLPKED
VLRYLDLLAAHKLNVFHFHLTDDQGWRIEIKRYPRLTEVGSWRSRTKYGHRASELWDETP
YGGFYTQDDIREIVAYAAERHIRVVPEIDIPGHSQATITAYPELGNTDVVDTTTLSVWDN
WGVSPNVLAPTEDTLRFFEGVLEEVLELFPAETSPFVHMGGDECPKDQWKESPLAQARIA
ELGVGDEDGLQSWFIRHFDAWLTERGRRLIGWDEILEGGLAEGAAVSSWRGYAGGVAAAE
AGHDVVMCPEQQVYLDHRQDGGPDEPMPIGYVRTLEDVYRFEPVPPGLSERAARHILGTQ
ANVWTEVMQNRARVDYQVFPRLAAFAEVAWSALPAPDDRDFAAFEARMTPHYARLDALGV
DYRPPGGPYPRQQRPGVLGFPREGAPPVV
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgcgaactccgtctccccgggcgccgtggaccccgcggccctcggtctgatc
ccggccccgcgcaccctgacggccgccgccgccgggccctacccgctcggctacgccacc
ccgctgacggcgggcccgggaaccgagggcgtcgcccgctggctgcgctccacgctcggc
ccggccaccggactgcccctgcccgcgggcgacggcaccggcacgggcgcgggcgacggc
tcgggaaccggctcgaacgggcagggcatcgtgctggccctggacgagtcgctcgccccg
gaggcgtaccgcctggaggtcggggcgaccgccgtgcgcatcaccggcggcaccgcggcc
ggcgtcttccggggcgcgcagacgctccggcagctcctcggcccggacgccttccggcgc
gctcccctcgccccgggccgcacctgggaggtcccgccggtcgtcgtcgaggacgagccc
cgcttcggctggcgcggcatgatgctcgacgtctcgcggcacttcctgcccaaggaagac
gtcctgcgctacctggacctgctggccgcgcacaagctgaacgtcttccacttccacctc
accgacgaccagggctggcgcatcgagatcaagcgctacccgcgcctgaccgaggtcggc
tcctggcgctcgcgcaccaagtacggccaccgggcctccgagctctgggacgagaccccc
tacggcggtttctacacccaggacgacatccgcgagatcgtcgcctacgccgccgagcgg
cacatccgggtggtccccgagatcgacatccccggccactcgcaggcgaccatcaccgcc
taccccgagctgggcaacaccgacgtcgtcgacaccaccaccctctccgtctgggacaac
tggggcgtcagcccgaacgtactcgcccccaccgaggacaccctgcgcttcttcgaaggc
gtcctggaggaggtgctcgaactcttccccgccgagacctcgcccttcgtccacatgggc
ggcgacgagtgccccaaggaccagtggaaggagtccccgctcgcccaggcccggatcgcc
gaactcggcgtcggcgacgaggacgggctccagtcctggttcatccggcacttcgacgcc
tggctcaccgagcggggccgccgcctcatcggctgggacgagatcctcgaagggggcctc
gccgagggagccgcggtctcctcctggcgcggctacgcgggaggcgtcgcggcggccgag
gccgggcacgacgtcgtcatgtgccccgagcagcaggtctacctggaccaccgtcaggac
ggcggccccgacgagccgatgcccatcgggtacgtccggaccctggaggacgtctaccgc
ttcgagcccgtcccgccgggcctgagcgagcgggcggcccggcacatcctgggcacccag
gccaacgtctggaccgaggtcatgcagaaccgggcccgcgtcgactaccaggtcttcccg
cgactcgccgccttcgccgaggtcgcctggtccgccctgcccgccccggacgaccgggac
ttcgccgcgttcgaggcccggatgacgccccactacgcccggctggacgccctcggcgtg
gactaccgcccgccgggcggcccctacccccggcagcagcgtcccggcgtcctcggcttc
ccgcgcgagggcgcgccgcccgtggtgtga

DBGET integrated database retrieval system