KEGG   Streptomyces griseus: SGR_4621Help
Entry
SGR_4621          CDS       T00691                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sgr  Streptomyces griseus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sgr00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(5431333..5431920)
Genome map
AA seq 195 aa AA seqDB search
MHRALIVVDVQNDFCEGGSLAVAGGADVAAAITDLIGDARPGYRHVVATRDHHVDPGDHF
SAEPDFEHSWPVHCVAGTEGVGFHPNFAPAVASGAIDTVFDKGAYAAAYSGFEGSDENGI
GLAQWLRDRDVTEVDVVGIATDHCVRATALDAAREGFVTQVLLDLTAGVSGATTERALDE
MRTAGVKLSGTPVVA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcgcattgatcgtcgtggacgttcagaacgacttctgcgagggcggcagcctc
gcggtggcgggcggcgccgatgtcgccgccgccatcaccgacctgatcggcgacgcccgg
cccggctaccgccacgtggtggccacccgcgaccaccacgtcgacccgggcgaccacttc
tcggccgaaccggacttcgagcactcctggccggtgcactgcgtcgccggtacggagggg
gtcggcttccacccgaacttcgcgcccgccgtcgcctccggcgcgatcgacacggtgttc
gacaagggggcgtacgcggccgcgtacagcgggttcgagggctccgacgagaacgggatc
ggcctcgcccagtggctgcgcgaccgcgacgtcaccgaggtcgacgtggtcggcatcgcc
accgatcactgtgtgcgggccaccgcgctggacgcggcccgtgagggcttcgtcacgcag
gtgctgctcgacctgaccgcgggcgtctccggggcgaccacggaacgggccctggacgag
atgcgcacggcgggcgtgaagctctccggcacaccggtcgtcgcctga

DBGET integrated database retrieval system