KEGG   Streptomyces griseus: SGR_4702Help
Entry
SGR_4702          CDS       T00691                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sgr  Streptomyces griseus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sgr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
5521691..5522737
Genome map
AA seq 348 aa AA seqDB search
MYGSYTGRSRTRGRAAGLRTTGTAAALGAALLLAGCSGDGEGGGKKSAPTVEQQPKDKDP
YWVNPDGNAARQVAAYTEDGDEKNAELIRRIARQPVGEWISPDNPEAEVKGVTEAAAAVD
RDALLVLYNIPHRDCGQFSKGGASDGNAYRAWLDGVAKGIGDRSATVILEPDALLHLVDG
CTPQEFHEERYDLLKGAIQRLKQQPATKVYLDAGNAGWQSPDALYQPLQRAGIAEADGFS
LNVSNFQTTAVSTEFGKKLSEKIGGKPFVIDTSRNGNGPYTGGDPAESWCNPPGRALGEV
PTTRTGDELVDAYLWVKRPGESDGDCKGGPKAGAWWPEYALGLAGATK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcagttacaccggccggtcccggacgcgcgggcgcgcggcgggcctgcggacg
accggcacggcggcggcgctcggagcggccctgctgctggcgggatgctccggcgacggg
gagggcggcgggaagaagagcgcgccgaccgtcgagcagcagcccaaggacaaggatccc
tactgggtcaaccccgacggcaacgcggcccgtcaggtcgccgcgtacaccgaggacggc
gacgagaagaacgccgagctgatccggcggatagcgcggcagccggtcggcgagtggatc
agcccggacaaccccgaggccgaggtcaagggcgtcaccgaggcggcggccgccgtcgac
cgggacgccctgctggtcctctacaacatcccgcaccgcgactgcggccagttctccaag
ggcggggcctccgacggcaacgcctaccgggcctggctggacggcgtcgccaagggcatc
ggggaccggagcgccacggtgatcctggagcccgacgccctgctccacctcgtcgacggc
tgcaccccccaggagttccacgaggagcgctacgacctcctcaagggcgcgatccagcgg
ctgaaacagcagcccgccaccaaggtctacctggacgcgggaaacgccggctggcagtcg
cccgacgccctgtaccagcccctccagcgggccgggatagccgaggcggacggtttctcg
ctgaacgtctccaacttccagaccacggccgtctccacggagttcggcaagaagctgtcg
gagaagatcggcggcaagcccttcgtcatcgacaccagccgcaacggcaacggcccctac
acgggcggcgatcccgccgagagctggtgcaaccccccgggccgcgccctgggcgaggtc
ccgaccacgcggaccggcgacgagctggtcgacgcctacctgtgggtcaagcggcccggc
gagtccgacggcgactgcaagggcggcccgaaggccggcgcctggtggccggagtacgcg
ctgggcctggccggcgccacgaagtag

DBGET integrated database retrieval system