KEGG   Streptomyces griseus: SGR_477Help
Entry
SGR_477           CDS       T00691                                 

Definition
(GenBank) putative cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
sgr  Streptomyces griseus
Pathway
sgr00984  Steroid degradation
sgr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SGR_477
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SGR_477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C Pyr_redox_2 FAD_binding_2 NAD_binding_8 DAO FAD_binding_3 GIDA Pyr_redox GMC_oxred_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: BAG17306
Kitasato: SGR477
UniProt: B1VQK5
Position
complement(557202..558845)
Genome map
AA seq 547 aa AA seqDB search
MGDTTVHKGGTQGVSRRRFITGTGSLLGGAAIAGHTAPAWATVRAAAAPIGSGARVPALV
IGTGYGGSVAALRLAQAGTDVHMVEMGMAWDTPGADGKIFANTTRPDDRSFWLRTRTKQP
LSNFLGFPIDRSVNRYTGILDAEEFAGITVYQGRGVGGGSLVNGGMAVTPRRENFGAILP
TVNAQEMYSTYYPRANSGLGVTTIDPAWFDSVDCYQYARVGRKHAQRSGFPFLFVPAVYD
WDYMKQEAAGTVPRSALDAEILYGNNYGKKSLQKTYIDRIRATGRVTISPLHKVTRVTPA
PGGGYTVLIDQLNTAGQTTATKTVTADKVFFAAGSVGTSKLLVGLKATGALPLLNDEIGK
GWGDNGNVMCGRANHLWDPTGKVQSSIPTGGIDNWDAGGAFAEVAPLPTGIETWASFYLS
ITKNPHRARFTWNAAAGKAELDWQTAWKQPSIDAAKTIFDKINQKEGTIYRTDLFGVHKI
WGDHLTYHPLGGAVLDKATDNYGRLHGYTGLYVIDGALIPGNTSVNPFVTITALAERNIE
RIIATDL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacactaccgtgcacaagggcgggactcagggtgtctcgcgtagaaggttcatc
acaggaacaggttctcttctgggtggagcggcgatcgccgggcacaccgcaccggcctgg
gcgaccgtccgggctgcggcagcgccgatcggctccggggcccgggtgccggccttggtc
atcggcaccggatacggcggctcggtggccgccctccggctcgcccaggccggtacggac
gtccacatggtcgagatggggatggcctgggacacgccgggcgcggacggcaagatcttc
gccaacaccaccaggccggacgaccgctccttctggctgcggacccgtaccaagcagccg
ctgagcaacttcctcggcttccccatcgaccgatccgtcaaccgctacaccggcatcctg
gacgccgaggagttcgccgggatcaccgtctaccagggccggggcgtcggcggcgggtcc
ctggtcaacggcggcatggccgtcaccccccgccgggagaacttcggagccatcctcccg
acggtgaacgcgcaggagatgtacagcacctactacccccgcgccaacagcggactgggc
gtcaccaccatcgatcccgcctggttcgactccgtcgactgctaccagtacgcccgggtc
ggccgaaaacacgcccagcgctccggcttccccttcctcttcgtccccgccgtctacgac
tgggactacatgaagcaggaggcggccggaaccgtccccaggtcggcgctggacgccgag
atcctctacggcaacaactacggcaagaagtcgctccagaagacctacatcgaccggatc
agggcgaccggccgggtcaccatctccccgctccacaaggtcaccagggtcaccccggcc
ccgggcggcggctacacggtgctcatcgaccagctgaacaccgccggccagaccaccgcc
accaagaccgtcacggcggacaaggtgttcttcgccgcgggcagcgtcggcaccagcaag
ctgctcgtcggcctcaaggccaccggtgcgctgcccctcctcaacgacgagatcggcaag
ggctggggcgacaacggcaacgtcatgtgcggccgggccaaccacctctgggacccgacg
gggaaggtgcagtcctccatccccaccggcgggatcgacaactgggacgcgggcggcgcg
ttcgccgaggtcgccccgctgcccaccgggatcgagacgtgggcctcgttctacctgtcg
attaccaagaacccccaccgcgcccggttcacctggaacgcggcggcggggaaggccgaa
ctggactggcagacggcgtggaagcagccgtccatcgatgcggcgaagaccatcttcgac
aagatcaaccagaaggagggcacgatctaccgcacggacctcttcggggtccacaagatc
tggggcgaccacctcacctaccacccgctcggcggcgcggtcctggacaaggccaccgac
aactatggccgactgcacgggtacacgggtctgtacgtcatcgacggcgcgctgatcccg
ggcaacaccagcgtcaacccgttcgtcaccatcaccgcgctcgccgagcgcaacatcgaa
cggatcatcgcgaccgacctctga

DBGET integrated database retrieval system