KEGG   Streptomyces griseus: SGR_4788Help
Entry
SGR_4788          CDS       T00691                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sgr  Streptomyces griseus
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sgr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
5624502..5625491
Genome map
AA seq 329 aa AA seqDB search
MSSTDAPRGPIDSSRVPRYAGPATFARLPRLDEVGRTDVAVVGVPFDTGVSYRPGARFGG
NAIREASRLLRPYNPAQDASPFALAQVADAGDIAANPFNINEAVETIEGAADDLLGTGAR
LMTLGGDHTIALPLLRSVAKKHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGIL
DTSALSHVGTRGPLYGKQDLTDDEKMGFGIVTSADVMRRGVDEIADQLRGRIGDRPLYIS
IDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLSSCHLVSADLVEVAPAYDHAEITSVA
ASHAAYELTTIMSRQIAAQREAKEAEDAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaccgacgcgccgcgcggccccatcgactcctcccgcgtcccgcggtacgcc
gggcccgcgacgttcgcccggctgccccggctcgacgaggtcggccgcaccgacgtcgcc
gtggtcggcgtgcccttcgacaccggggtctcctaccgccccggcgcccgcttcggcggc
aacgccatccgtgaggcctcccggctgctgcgcccgtacaacccggcgcaggacgcctcc
ccgttcgccctcgcgcaggtcgccgacgccggcgacatcgcggcgaacccgttcaacatc
aacgaggccgtcgagaccatcgagggcgcggccgacgacctgctgggcaccggcgcacgc
ctgatgaccctcggcggcgaccacaccatcgccctgcccctgctgcgctccgtcgccaag
aagcacgggcccgtcgccctgctccacttcgacgcgcacctggacacctgggacacctac
ttcggcgccgagtacacccacggcaccccgttccgccgggccgtcgaggagggcatcctc
gacacctccgccctctcccacgtcggcacccgcggcccgctctacggcaagcaggacctg
accgacgacgagaagatgggcttcggcatcgtcacctccgccgacgtcatgcggcgcggc
gtcgacgagatcgccgaccagctgcgcgggcgcatcggcgaccggccgctctacatctcc
atcgacatcgacgtcctggacccggcgcacgcccccggcaccggcacccccgaggccggc
ggcctcacctcccgcgaactgctggagatcctgcgcggcctctcctcctgccacctggtc
tccgccgacctggtcgaggtcgccccggcgtacgaccacgccgagatcacctccgtggcc
gcctcgcacgccgcgtacgagctgacgacgatcatgtcccggcagatcgccgcgcagcgg
gaagcgaaggaagccgaggacgccaagtga

DBGET integrated database retrieval system