KEGG   Streptomyces griseus: SGR_4795Help
Entry
SGR_4795          CDS       T00691                                 

Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sgr  Streptomyces griseus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sgr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sgr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(5634811..5636643)
Genome map
AA seq 610 aa AA seqDB search
MPHRTSRRTLLTATAAATAAAATGALAVPSAASAHPTNASSDRRLRRIIAGMSLEEKVGQ
LFVMRVYGHSATDPDQADIDANLKEIGVRTAAELISTYHVGGIIYFTWAHNTRDPHQIAD
LSNGLQRAALAGRSRLPLLVSTDQEHGIVCRVGEPATLLPGAMALGAGGSRSDTRRAARI
AGAELAALGINQNYAPDADVNVNPANPVIGVRSFGSDPAAVAALVAEQVKGYQGAGVAST
AKHFPGHGDTSTDSHTGLPVINHTRAQWEELDAPPFRAAVRARIDSIMTAHIVVPALDPS
EDPATLSRPILTGILREELGYDGVVVTDSLGMEGVRTKYGDDRVPVLALLAGVDQLLNPP
NLSVAWNAVVAAVQGGEISEARVDESILRILRLKDRLGLFRDPFVSRRDVGRTVGSRAHR
AAADRIAERTTTLLADPGALLPLSRRSHRDLLVVGADPASPSGTTGPPTSTLRDAFGELG
FTATALSTGTAPNQAKIAEAVAAARGRDAVVVATYNVTATSAQRTLVTALVATGVPVVAV
AVRNPYDIAHLTGTGVAASLAAYSWTDVELRAAARVIAGHADPRGTLPVPVQRADDPTQV
LYPVGHGMSY
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
gtgccccaccgcacctcaagacgcaccctcctcaccgccaccgcggccgccacggccgcg
gcggccaccggcgccctcgccgtcccctccgccgcttccgcgcaccccacgaacgcctcc
tccgaccgccggctgcgacggatcatcgccgggatgagcctggaggagaaggtcggccag
ctgttcgtgatgcgggtctacgggcactccgccaccgaccccgaccaggcggacatcgac
gcgaacctcaaggagatcggggtccgtacggccgccgagttgatctccacgtaccacgtc
ggcggcatcatctacttcacctgggcgcacaacacccgcgacccgcaccagatcgccgac
ctctccaacggcctccagcgcgccgcgctcgccgggcgctcccggctgccgctgctcgtc
tccaccgaccaggaacacggcatcgtctgccgggtcggcgaacccgccacactgctgccg
ggcgcgatggccctgggcgcgggcggctcgcgctccgacacccgccgggcggcccggatc
gcgggcgccgaactcgccgcgctcggcatcaaccagaactacgcgccggacgccgacgtc
aacgtcaacccggccaacccggtcatcggcgtacggtccttcggctccgaccccgccgcg
gtggccgccctggtcgcggagcaggtgaaggggtaccagggcgcgggcgtcgcgtcgacc
gccaagcacttccccggccacggggacaccagcaccgacagccacaccgggctgcccgtc
atcaaccacacccgggcccagtgggaggagttggacgccccgccgttccgcgccgccgtc
cgggcccggatcgactcgatcatgaccgcgcacatcgtggtccccgcactcgacccgtcc
gaggacccggccacgctctcccggccgatcctcaccggcatcctccgcgaggagctcggc
tacgacggggtggtggtcaccgactccctcggcatggagggggtgcgcacgaagtacggc
gacgaccgcgtgccggtcctggcgctgctggcgggcgtggaccagctgctcaacccgccg
aacctctccgtcgcctggaacgccgtggtggcggcggtgcagggcggcgagatcagcgag
gcgagagtcgatgaatcgatcctgcggatcctgcggctgaaggaccggctgggcctgttc
cgcgacccgttcgtcagtcggcgggacgtcgggcgcacggtcggcagccgcgcccaccgg
gccgccgccgaccggatcgccgaacgcacgaccaccctgctcgccgacccgggcgccctg
ctgccgctctcccgccgcagccaccgcgacctgctggtggtgggggccgatccggcctcc
ccctccgggacgacgggcccgccgaccagcaccctgcgcgacgccttcggcgaactgggc
ttcacggcgacggcgttgtccaccggtacggctccgaaccaggcgaagatcgccgaagcg
gtcgccgcggcccggggccgggacgcggtcgtcgtggcgacgtacaacgtcacggcgacc
agcgcgcagcgcaccctggtcaccgccctcgtggcgaccggcgtcccggtggtggccgtc
gccgtccgcaacccctacgacatcgcccacctcaccgggaccggagtcgcggcgagcctc
gccgcgtactcctggaccgatgtcgaactgcgcgccgcggcccgggtgatcgcgggccac
gccgacccgcggggcaccctcccggtcccggtgcagcgcgcggacgacccgacgcaggtg
ctgtatccggtgggccacggcatgtcgtactag

DBGET integrated database retrieval system