KEGG   Streptomyces griseus: SGR_4795Help
Entry
SGR_4795          CDS       T00691                                 

Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sgr  Streptomyces griseus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SGR_4795
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SGR_4795
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SGR_4795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(5634811..5636643)
Genome map
AA seq 610 aa AA seqDB search
MPHRTSRRTLLTATAAATAAAATGALAVPSAASAHPTNASSDRRLRRIIAGMSLEEKVGQ
LFVMRVYGHSATDPDQADIDANLKEIGVRTAAELISTYHVGGIIYFTWAHNTRDPHQIAD
LSNGLQRAALAGRSRLPLLVSTDQEHGIVCRVGEPATLLPGAMALGAGGSRSDTRRAARI
AGAELAALGINQNYAPDADVNVNPANPVIGVRSFGSDPAAVAALVAEQVKGYQGAGVAST
AKHFPGHGDTSTDSHTGLPVINHTRAQWEELDAPPFRAAVRARIDSIMTAHIVVPALDPS
EDPATLSRPILTGILREELGYDGVVVTDSLGMEGVRTKYGDDRVPVLALLAGVDQLLNPP
NLSVAWNAVVAAVQGGEISEARVDESILRILRLKDRLGLFRDPFVSRRDVGRTVGSRAHR
AAADRIAERTTTLLADPGALLPLSRRSHRDLLVVGADPASPSGTTGPPTSTLRDAFGELG
FTATALSTGTAPNQAKIAEAVAAARGRDAVVVATYNVTATSAQRTLVTALVATGVPVVAV
AVRNPYDIAHLTGTGVAASLAAYSWTDVELRAAARVIAGHADPRGTLPVPVQRADDPTQV
LYPVGHGMSY
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
gtgccccaccgcacctcaagacgcaccctcctcaccgccaccgcggccgccacggccgcg
gcggccaccggcgccctcgccgtcccctccgccgcttccgcgcaccccacgaacgcctcc
tccgaccgccggctgcgacggatcatcgccgggatgagcctggaggagaaggtcggccag
ctgttcgtgatgcgggtctacgggcactccgccaccgaccccgaccaggcggacatcgac
gcgaacctcaaggagatcggggtccgtacggccgccgagttgatctccacgtaccacgtc
ggcggcatcatctacttcacctgggcgcacaacacccgcgacccgcaccagatcgccgac
ctctccaacggcctccagcgcgccgcgctcgccgggcgctcccggctgccgctgctcgtc
tccaccgaccaggaacacggcatcgtctgccgggtcggcgaacccgccacactgctgccg
ggcgcgatggccctgggcgcgggcggctcgcgctccgacacccgccgggcggcccggatc
gcgggcgccgaactcgccgcgctcggcatcaaccagaactacgcgccggacgccgacgtc
aacgtcaacccggccaacccggtcatcggcgtacggtccttcggctccgaccccgccgcg
gtggccgccctggtcgcggagcaggtgaaggggtaccagggcgcgggcgtcgcgtcgacc
gccaagcacttccccggccacggggacaccagcaccgacagccacaccgggctgcccgtc
atcaaccacacccgggcccagtgggaggagttggacgccccgccgttccgcgccgccgtc
cgggcccggatcgactcgatcatgaccgcgcacatcgtggtccccgcactcgacccgtcc
gaggacccggccacgctctcccggccgatcctcaccggcatcctccgcgaggagctcggc
tacgacggggtggtggtcaccgactccctcggcatggagggggtgcgcacgaagtacggc
gacgaccgcgtgccggtcctggcgctgctggcgggcgtggaccagctgctcaacccgccg
aacctctccgtcgcctggaacgccgtggtggcggcggtgcagggcggcgagatcagcgag
gcgagagtcgatgaatcgatcctgcggatcctgcggctgaaggaccggctgggcctgttc
cgcgacccgttcgtcagtcggcgggacgtcgggcgcacggtcggcagccgcgcccaccgg
gccgccgccgaccggatcgccgaacgcacgaccaccctgctcgccgacccgggcgccctg
ctgccgctctcccgccgcagccaccgcgacctgctggtggtgggggccgatccggcctcc
ccctccgggacgacgggcccgccgaccagcaccctgcgcgacgccttcggcgaactgggc
ttcacggcgacggcgttgtccaccggtacggctccgaaccaggcgaagatcgccgaagcg
gtcgccgcggcccggggccgggacgcggtcgtcgtggcgacgtacaacgtcacggcgacc
agcgcgcagcgcaccctggtcaccgccctcgtggcgaccggcgtcccggtggtggccgtc
gccgtccgcaacccctacgacatcgcccacctcaccgggaccggagtcgcggcgagcctc
gccgcgtactcctggaccgatgtcgaactgcgcgccgcggcccgggtgatcgcgggccac
gccgacccgcggggcaccctcccggtcccggtgcagcgcgcggacgacccgacgcaggtg
ctgtatccggtgggccacggcatgtcgtactag

DBGET integrated database retrieval system