KEGG   Streptomyces griseus: SGR_4825Help
Entry
SGR_4825          CDS       T00691                                 

Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sgr  Streptomyces griseus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SGR_4825
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SGR_4825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
5672886..5675111
Genome map
AA seq 741 aa AA seqDB search
MSNMAVLEGVLERITYANEENGYTVARVDTGRGAGDLLTVVGALLGAQVGESLRMEGRWG
SHAQYGKQFTVENYTTVLPATIQGIRRYLGSGLIKGIGPVMADRITTHFGVDTLDIIERE
PKRLVEVPGLGPKRTKMIATAWEEQKAIKEVMVFLQSVEVSTSIAVRIYKKYEDASISVV
KNQPYRLAADVWGIGFLTADRIAQAVGIPHDSPERVKAGLQYALSQSSDQGHCFLPEERL
IADGVKLLQVDTGLVIECLAELAADPEGVVREKVPSPDGGEPITAVYLVPFHRAELSLAG
QVRRLLKTGEDRMPAFRDVDWDKALAWLATRTGATLAPEQEQAVRLALSRKVAVLTGGPG
CGKSFTVRSIVELARAKKAKVVLAAPTGRAAKRLSELTGAEASTVHRLLELKPGGDAAYD
RDRPLDADLVVVDEASMLDLLLANKLVKAVAPGAHLLLVGDVDQLPSVGAGEVLGDLLAE
GGPVPAVRLTRIFRQAQQSGVVTNAHRINAGQPPLTEGLSDFFLFVEDETEDAGKLAVDV
AARRIPAKFGLDPRRDVQVLAPMHRGPAGAGNLNGLLQQAITPGRPDLPEKRFGGRVFRV
GDKVTQIRNNYDKGENGVFNGTVGVVTGLDVDEQRLTVHTDEDEEIGYDFDELDELAHAY
AMTIHRSQGSEYPAVVIPVTTSAWMMLQRNLLYTAVTRAKKLVVLVGSRKAIGQAVRTVS
AGRRCTALDFRLRGGSGEDFA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacatggccgtcctcgaaggtgtcctggagcggatcacctacgccaacgaggag
aacgggtacacggtcgcccgcgtcgacaccgggcggggagcgggcgacctcctcaccgtg
gtcggcgctctgctcggcgcgcaggtcggcgagtcgctgcggatggagggccgttggggc
tcgcacgcgcagtacggcaagcagttcaccgtggagaactacaccaccgtgctgcccgcc
accatccagggcatccgccgctatctcggctcggggctgatcaaggggatcgggccggtg
atggccgaccggatcaccacccacttcggcgtcgacaccctcgacatcatcgagcgggag
ccgaagcgcctcgtcgaggtccccggcctcggccccaagcgcaccaagatgatcgccacc
gcctgggaggagcagaaggcgatcaaggaggtcatggtcttcctccagagcgtcgaggtc
tccacctccatcgccgtccgcatctacaagaagtacgaggacgcctcgatctccgtcgtg
aagaaccagccctaccggctggccgccgacgtctggggcatcggcttcctcaccgccgac
cggatcgcccaggccgtcggcatcccgcacgacagccccgagcgggtcaaggccggcctc
cagtacgccctgtcccagtcctccgaccaggggcactgcttcctccccgaggagcggctc
atcgcggacggcgtcaagctgctccaggtcgacaccgggctggtcatcgagtgcctggcc
gagctggccgccgacccggagggcgtcgtacgggagaaggtgccgtcccccgacggcggc
gagccgatcaccgccgtctacctcgtccccttccaccgtgccgagctgtccctcgccggg
caggtgcgccgcctgctgaagaccggcgaggaccgcatgccggccttccgggacgtggac
tgggacaaggccctggcctggctcgccacccgtacgggagccaccctcgcgcccgaacag
gagcaggccgtacggctcgcgctcagccggaaggtggccgtcctgaccggcggccccggc
tgcggcaagtcgttcaccgtacggtccatcgtcgaactggcccgggcgaagaaggccaag
gtggtgctcgccgcccccaccgggcgcgccgccaaacgcctctccgagctgaccggggcc
gaggcgtccaccgtgcaccggctcctggagctgaagccgggcggggacgccgcctacgac
cgggaccgcccgctggacgccgatctggtcgtggtggacgaggcgtcgatgctcgacctg
ctgctcgccaacaagctcgtgaaggcggtggcacccggtgcccacctcctcctcgtgggc
gacgtcgaccagttgccctcggtcggcgcgggggaggtgctgggcgatctgctcgcggag
ggcggcccggtccccgccgtccggctcacccggatcttccgccaggcccagcagtccggc
gtggtcaccaacgcccaccggatcaacgccgggcagccgccgctcaccgaggggctcagc
gacttcttcctcttcgtggaggacgagaccgaggacgcgggcaagctcgccgtcgatgtg
gcggcccgtcgcattccggccaagttcggcctcgatccccgccgtgacgtgcaggttctc
gccccgatgcaccggggtccggcgggcgcggggaatctgaacgggctgctccagcaggcc
atcaccccgggccgtcccgatctccccgaaaagcggttcggcggccgggtcttccgggtc
ggcgacaaggtcacccagatccgcaacaactacgacaagggcgagaacggcgtcttcaac
ggcacggtcggcgtcgtcaccggcctcgacgtcgacgaacagcggctcaccgtccacacc
gacgaggacgaggagatcgggtacgacttcgacgaactggacgagctggcccacgcgtac
gccatgaccatccaccgctcccagggcagcgagtatccggccgtcgtcatccccgtcacc
accagtgcctggatgatgctccagcgcaacctgctctacacggccgtgacgcgggccaag
aagctggtggtgctggtcgggtcccgtaaggcgatcggtcaggcggtccgcacggtttcc
gcaggcaggcgctgtacggcactggatttccggctccggggcggctccggagaagacttc
gcgtga

DBGET integrated database retrieval system