KEGG   Streptomyces griseus: SGR_4879Help
Entry
SGR_4879          CDS       T00691                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sgr  Streptomyces griseus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sgr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
5748763..5751282
Genome map
AA seq 839 aa AA seqDB search
MGLSRLAALHGVATSYSPSPDVTVSVPDDTVIAVLAALGVDAGTPADVRKCLVAAESRSR
LLPPTVVVWAGEPLPPSLAGLPSGSTVTVEPEPADTPGPSGRPPAPLSMRARASAPAPPV
PPPPGAAAAPLTPPGTAATTTAPVAAAAAAPPATEAAAPAAVAVPPVTQAGNADSAPAVT
PVAGTATASASPAASASASASPSATASAPATASAPATASAPATALPSASAPHTHPRRADE
APVVPAAVPAWWIPPPPGVHRVHVRTPDHRRATATLVVAPARVPQPPERSHGFLVQLYSL
LSARSWGMGDLGDLADLAAWAGRTLGSGFVQVNPLHAAVPGRPTDPSPYRPSSRRFPDPV
HLRVESVPEYGHVRDRAALDDLRQGADALSEAVLNKGALIDRDAVWELKRQALELVVEVP
LTPGRRAAYCDFLAEQGQALEDHALWCALAEVHGPDWRTWPEALRDPRSSGTARARSELL
DRVDFHCRLAWLTADQLAAAQRAAEEAGMSVGIVHDLAVGVHPAGADTWAQQEAFAHGMS
VGAPPDAFNARGQDWGLPPWRPDTLAATGYAAYRGLLRGLLAGAGALRIDHVMGLFRLWW
VPEGSPPTDGTYVAHDAEAMLAVLVLEAHRAGTVVVGEDLGTVAPGVREALARRGVLGTS
VLWFERDWDGDGRPIAPEKWRRDCLATATTHDLPSTAARLTGDHVTLRHRLGLLTRSLEE
ELTADLTDTAEWLALLARLRMLPEGDGDEEAAVRAVHRFLLRTPARMTGVWLPDTVGDRR
PQNLPGTWDQYPNWRLPIADAEGHPVTLEEITASPRLHALMDVLRPRKPHTAPPGERRP
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgtcccggctcgccgcactgcacggtgtcgccacctcctactccccgtcgccg
gatgtcacggtgtccgtccccgacgacacggtcatcgccgtgctcgccgcgctgggcgtc
gacgccggcactccggcggacgtacggaagtgcctcgtcgccgcggagtcccgctcgcgc
ctgctgccgccgaccgtggtggtctgggccggcgagcccctgccgccctccctcgccggg
ctgccctccggctcgaccgtcacggtcgagccggagccggccgacaccccgggcccctcg
ggccgcccgcccgccccgctgagcatgcgggcccgggcgtcggcccccgccccgcccgtg
ccgccgcccccgggagccgctgccgcgcccctgacgccccccgggaccgccgccaccacc
accgcgcccgtcgccgccgcagccgccgcgccgcccgccacggaagccgccgcgcccgcc
gcagtcgccgtgccgcccgtgacgcaggcgggaaacgcggactccgccccggccgtgacg
cccgtcgcggggaccgccaccgcatcggcgtcccccgccgcgtccgcgtccgcgtccgcg
tcaccgtccgccaccgcgtccgcgcccgccaccgcgtccgcgcccgccaccgcgtccgcg
cccgccaccgccctcccgtcggcatccgcgccgcacacgcacccgcgtcgcgccgacgag
gcgcccgtggtcccggcggccgttcccgcctggtggatcccgccgccccccggcgtccac
cgcgtccacgtccgtacgccggaccaccgccgcgccacggccaccctcgtcgtcgccccg
gcccgcgtcccccagccgcccgagcgctcccacggcttcctggtccagctctactccctg
ctctccgcccgctcctggggcatgggcgacctcggtgacctggccgacctcgccgcctgg
gccggtcggaccctcggctccgggttcgtccaggtcaacccgttgcacgcggctgttccc
gggcggccgaccgacccctccccctaccgcccgtcctcgcgccggttccccgatccggtg
cacctgcgcgtcgagtcggtccccgaatacggccacgtccgcgaccgggccgccctggac
gacctccggcagggcgccgacgccctcagcgaggccgtgctgaacaagggcgccctgatc
gaccgggacgccgtctgggagctgaagcggcaggccctggagctggtcgtcgaggtgccg
ctcacccccggccgccgcgccgcctactgcgacttcctggccgagcagggccaggcgctg
gaggaccacgccctgtggtgcgcgctcgccgaggtgcacggccccgactggcgcacctgg
cccgaggccctgcgcgacccccgctcgtccgggaccgcccgcgcccgctccgaactgctc
gaccgggtcgacttccactgccgcctcgcctggctgaccgccgaccagctcgccgccgcc
cagcgcgccgccgaggaagcagggatgagcgtcgggatcgtccacgacctcgccgtcggc
gtgcacccggccggcgccgacacctgggcccagcaggaggccttcgcccacggcatgtcc
gtcggcgcgccgcccgacgccttcaacgcgcgcggccaggactggggcctgccgccctgg
cgccccgacaccctcgccgccaccggctacgccgcctaccggggcctgctgcgcggactg
ctggccggcgccggggccctgcgcatcgaccacgtcatgggcctgttccggctctggtgg
gtgcccgagggcagcccgcccaccgacggcacgtacgtcgcccacgacgccgaggcgatg
ctcgccgtcctcgtcctggaggcccaccgggccggcaccgtcgtcgtcggcgaggacctc
ggcaccgtcgcccccggggtgcgcgaggcgctcgcccggcgcggcgtgctcggcacctcg
gtgctctggttcgaacgggactgggacggcgacggacggccgatcgccccggagaagtgg
cgccgggactgcctggccaccgccaccacccacgatctgccctccaccgccgcccggctg
accggcgaccatgtgacgctgcgccaccggctcggcctgctcacccgctccctggaggag
gagctgaccgccgacctcaccgacaccgccgaatggctggcgctcctcgcccggctgcgg
atgctccccgagggcgacggcgacgaggaggccgccgtccgggccgtccaccgcttcctg
ctgcgcacccccgcccggatgaccggcgtctggctccccgacaccgtcggcgaccgccgc
ccgcagaacctccccggcacctgggaccagtaccccaactggcgcctcccgatcgccgac
gccgaggggcatccggtcaccctggaggagatcaccgcctcgccccggctgcacgcgctg
atggacgtcctgcggccccgaaagcctcatacggcacccccgggcgagcgccgtccctag

DBGET integrated database retrieval system