KEGG   Streptomyces griseus: SGR_4960Help
Entry
SGR_4960          CDS       T00691                                 

Definition
(GenBank) putative glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sgr  Streptomyces griseus
Pathway
sgr00330  Arginine and proline metabolism
sgr00332  Carbapenem biosynthesis
sgr01100  Metabolic pathways
sgr01130  Biosynthesis of antibiotics
sgr01230  Biosynthesis of amino acids
Module
sgr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SGR_4960
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SGR_4960
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SGR_4960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Pertussis_S2S3
Motif
Other DBs
NCBI-ProteinID: BAG21789
Kitasato: SGR4960
UniProt: B1VXE3
Position
5854635..5855789
Genome map
AA seq 384 aa AA seqDB search
MAEQRPSGREPAVTGARRVVVKVGSSSLTTASGGLDADRVDALVDVLAKVRDGGEREVVL
VSSGAIAAGLAPLGLVRRPKDLARQQAAASVGQGLLVARYTASFARYGVRVGQVLLTADD
TSRRGHYRNAYSTLDKLLEMGAVPVVNENDTVATDEIRFGDNDRLAALVAHLVHADLLVL
LSDVDGLYDGPPGTPGAARIAEVTGPDDLTGVTIGSAGKAGVGTGGMVTKVEAARIATAA
GIPVVLTSASRVADALAGRDTGTYFHPTGRRSADRLLWLAHASTPQGALTLDDGAVRAVV
ERRTSLLPAGISAVEGEFSAGDPVELRDPHGTPVARGLVNFDAKEIPQLLGRSTRDLARE
LGPAYEREVVHRDDLVLLAPRLTP
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtggcagagcagaggccgtcgggccgcgagccggcggtgaccggcgcccgcagggtcgtc
gtcaaggtcggctcctcctcgctcaccaccgcatccggcggcctcgacgccgaccgcgtc
gacgccctcgtcgacgtcctggccaaggtcagggacggcggcgaacgcgaggtcgtcctc
gtctccagcggagccatcgccgccggactcgccccgctcggcctcgtccgccggcccaag
gacctcgcccggcagcaggccgccgccagcgtcggccagggcctcctggtggcccgctac
accgcctccttcgcccgctacggcgtccgcgtcggccaagtgctcctcaccgccgacgac
accagccgccgcggccactaccgcaacgcctacagcaccctggacaagctcctggagatg
ggcgccgtccccgtcgtcaacgagaacgacaccgtcgccaccgacgagatccgcttcggc
gacaacgaccggctcgccgccctcgtcgcccacctcgtccacgccgacctgctcgtcctg
ctctccgacgtggacggcctctacgacggaccgcccggcacccccggcgccgcccggatc
gccgaggtcaccggccccgacgacctgaccggcgtcaccatcggcagcgccggcaaggcc
ggcgtcggcaccggcggcatggtcaccaaggtcgaggccgcccgcatcgccaccgccgcc
ggcatccccgtcgtcctcacctccgccagccgcgtcgccgacgcgctcgcgggccgcgac
accggaacctacttccaccccaccggacgccgctccgccgaccggctcctgtggctggcc
cacgcctccaccccacagggcgcgctcaccctcgacgacggcgccgtacgggccgtggtg
gagcggcgcacctccctgctgcccgccggaatctccgccgtcgagggcgagttcagcgcc
ggcgacccggtcgagctgcgcgatccgcacggcaccccggtcgcccgcggactcgtcaac
ttcgacgcgaaggagatcccccaactgctcggccgctccacccgggacctcgcccgcgaa
ctgggtcccgcctacgaacgcgaggtcgtacacagggacgatctggtcctcctcgcgccg
cgcctcaccccctga

DBGET integrated database retrieval system