KEGG   Streptomyces griseus: SGR_4960Help
Entry
SGR_4960          CDS       T00691                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sgr  Streptomyces griseus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGR_4960
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SGR_4960
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SGR_4960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
5854635..5855789
Genome map
AA seq 384 aa AA seqDB search
MAEQRPSGREPAVTGARRVVVKVGSSSLTTASGGLDADRVDALVDVLAKVRDGGEREVVL
VSSGAIAAGLAPLGLVRRPKDLARQQAAASVGQGLLVARYTASFARYGVRVGQVLLTADD
TSRRGHYRNAYSTLDKLLEMGAVPVVNENDTVATDEIRFGDNDRLAALVAHLVHADLLVL
LSDVDGLYDGPPGTPGAARIAEVTGPDDLTGVTIGSAGKAGVGTGGMVTKVEAARIATAA
GIPVVLTSASRVADALAGRDTGTYFHPTGRRSADRLLWLAHASTPQGALTLDDGAVRAVV
ERRTSLLPAGISAVEGEFSAGDPVELRDPHGTPVARGLVNFDAKEIPQLLGRSTRDLARE
LGPAYEREVVHRDDLVLLAPRLTP
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtggcagagcagaggccgtcgggccgcgagccggcggtgaccggcgcccgcagggtcgtc
gtcaaggtcggctcctcctcgctcaccaccgcatccggcggcctcgacgccgaccgcgtc
gacgccctcgtcgacgtcctggccaaggtcagggacggcggcgaacgcgaggtcgtcctc
gtctccagcggagccatcgccgccggactcgccccgctcggcctcgtccgccggcccaag
gacctcgcccggcagcaggccgccgccagcgtcggccagggcctcctggtggcccgctac
accgcctccttcgcccgctacggcgtccgcgtcggccaagtgctcctcaccgccgacgac
accagccgccgcggccactaccgcaacgcctacagcaccctggacaagctcctggagatg
ggcgccgtccccgtcgtcaacgagaacgacaccgtcgccaccgacgagatccgcttcggc
gacaacgaccggctcgccgccctcgtcgcccacctcgtccacgccgacctgctcgtcctg
ctctccgacgtggacggcctctacgacggaccgcccggcacccccggcgccgcccggatc
gccgaggtcaccggccccgacgacctgaccggcgtcaccatcggcagcgccggcaaggcc
ggcgtcggcaccggcggcatggtcaccaaggtcgaggccgcccgcatcgccaccgccgcc
ggcatccccgtcgtcctcacctccgccagccgcgtcgccgacgcgctcgcgggccgcgac
accggaacctacttccaccccaccggacgccgctccgccgaccggctcctgtggctggcc
cacgcctccaccccacagggcgcgctcaccctcgacgacggcgccgtacgggccgtggtg
gagcggcgcacctccctgctgcccgccggaatctccgccgtcgagggcgagttcagcgcc
ggcgacccggtcgagctgcgcgatccgcacggcaccccggtcgcccgcggactcgtcaac
ttcgacgcgaaggagatcccccaactgctcggccgctccacccgggacctcgcccgcgaa
ctgggtcccgcctacgaacgcgaggtcgtacacagggacgatctggtcctcctcgcgccg
cgcctcaccccctga

DBGET integrated database retrieval system