KEGG   Streptomyces griseus: SGR_5040Help
Entry
SGR_5040          CDS       T00691                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sgr  Streptomyces griseus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sgr00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sgr00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:sgr00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
5934903..5935871
Genome map
AA seq 322 aa AA seqDB search
MSHPSAAPRAGSAAPPAGAHRFSSVISRIAEEMGALADHGTPADYIPMLAGADPRRFGMA
VAEPDGTVYGVGDWRQPFSTQSISKVFALALALSLDGERIWRGVGREPSGNPFNSLVQLE
YENGIPRNPFINAGALVVTDRLQALTGDAAGRVRELLRSESGNPAIDFVPEVAASEAAFG
DRNAALAHFMASYDNITLPVPELLAAYFRQCSIEASCADLALSAGFLARGGTLADGSALL
TRSQAKQVNAVMLTCGTYDAAGEFAYRVGLPGKSGVGGGIIAIVPGECTLCVWSPGLDRR
GNSVAGVSALARFTTLTGLSVF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccacccctccgccgcccctcgggcgggcagtgccgctccgcccgccggagcgcac
cgcttcagctccgtcatcagccgcatcgcggaggagatgggcgcactcgccgaccacggc
actcccgccgactacatcccgatgctcgccggcgccgacccccggcgcttcggcatggcc
gtcgccgagcccgacggaaccgtctacggcgtcggtgactggcggcagccgttctcgacc
cagtccatatccaaggtgttcgccctggccctggccctctccctggacggcgagcggata
tggcggggagtgggccgggagccctcgggcaacccgttcaactccctggtgcagttggag
tacgagaacggcatcccccgcaaccccttcatcaacgccggcgccctggtggtgaccgac
cggctgcaggcactgaccggggacgccgcaggccgggtgcgggagctgctgcgctcggag
agcggcaaccccgccatcgacttcgtgccggaggtcgccgcctccgaggcggccttcggc
gaccgcaacgccgcgctggcccacttcatggcctcctacgacaacatcacgctcccggtc
cccgaactgctcgccgcctacttccgccagtgctcgatcgaggcgtcctgcgcggacctg
gccctctcggcggggttcctcgcccggggcgggaccctggccgacgggtccgcgctgctg
acccgcagccaggcgaagcaggtcaacgcggtcatgctcacctgcgggacgtacgacgcg
gccggagagttcgcctaccgggtggggctgccgggcaagagcggggtcggcggggggatc
atcgcgatcgtgcccggcgagtgcaccctgtgcgtatggagcccggggctcgaccggcgc
ggcaactcggtggcgggcgtgtcggcgctcgcccgcttcaccacgctgaccgggctgtcc
gtcttctga

DBGET integrated database retrieval system