KEGG   Streptomyces griseus: SGR_5329Help
Entry
SGR_5329          CDS       T00691                                 

Definition
dihydrolipoamide S-succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sgr  Streptomyces griseus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGR_5329
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SGR_5329
  Amino acid metabolism
   00310 Lysine degradation
    SGR_5329
Enzymes [BR:sgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SGR_5329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(6272851..6274677)
Genome map
AA seq 608 aa AA seqDB search
MSVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPAPASGVLSSIK
VAEDETVEVGAELAVIDDGSGAPAEAEAAAPAAEEAPAAEAPAPAAEEPAAPAQEAPQAE
APAASGGSAEGTDVTLPALGESVTEGTVTRWLKEVGEEVAEDEPLLEVSTDKVDTEIPAP
VAGVLLEIVVGEDETAEVGAKLAVIGAPGSAPAAAPAQPAAPAAAPAQPAAPAQEAPKAE
APKAEAPKQEAPAAPAPAPAAPAAPAAPAQAPAAPAAPAPAQPAPAAPAPAAQAAPSGDD
GAYVTPLVRKLASENNVDLSAVKGTGVGGRIRKQDVVAAAEAAKAAAAAPAPAAPAAAKA
APKLEASPLRGQTVKMTRMRKVIGENMMKALHSQAQLTTVLEVDITKLMKLRNQAKAAFA
AREGVKLSPMPFFVKAAAQALKAHPVVNARINEDEGTITYFDSENIGIAVDAEKGLMTPV
IKGAGDLNIAGIAKKTAELAGKARGGGLTPDDMSGATFTISNTGSRGALFDTVIVPPNQA
AILGIGATVRRPVVIDHPDLGETIAVRDMTYLSLSYDHRLVDGADAARYLTSVKAILEAG
EFEVELGL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttccgtaacccttccggcgctcggcgagagcgtcaccgagggcactgtcacc
cgttggctgaaggccgagggcgagcgcgtcgaggccgacgagccgttgctcgaggtctcg
accgacaaggtcgacaccgagatcccggcccccgcgtccggcgttctgtcgtccatcaag
gtcgccgaggacgagaccgtcgaggtcggcgccgagctggccgtcatcgacgacggctcg
ggcgctccggccgaggccgaggccgcggcccccgccgccgaggaggccccggccgccgag
gctccggcccccgccgccgaggagcccgccgctccggcccaggaggccccccaggccgag
gccccggccgcctccggcggttccgccgagggcaccgacgtcaccctccccgcgctcggc
gagagcgtcaccgagggcaccgtcacgcgctggctcaaggaggtcggcgaggaggtggcc
gaggacgagccgctgctggaggtctccacggacaaggtcgacaccgagatccccgccccg
gtcgccggtgtgctgctggagatcgtggtcggcgaggacgagaccgccgaggtcggcgcc
aagctcgccgtcatcggcgccccgggctcggccccggccgccgctccggcgcagcccgcc
gccccggccgccgctccggcgcagcccgccgccccggcccaggaggccccgaaggccgag
gcccccaaggccgaggcgccgaagcaggaggcccccgcggcccccgccccggcccccgcc
gctccggccgcccccgcggctccggcgcaggccccggcggctcccgccgccccggctccg
gcgcagcccgcccccgccgccccggcgccggccgcccaggccgcgccctccggtgacgac
ggcgcgtacgtcacgccgctggtccgcaagctcgcgtccgagaacaacgtggacctgagc
gcggtcaagggcaccggcgtcggcggccgcatccgcaagcaggacgtcgtcgccgccgcg
gaggccgccaaggccgcggcggctgccccggcacccgccgctccggccgccgccaaggcc
gcgccgaagctggaggcctccccgctgcgcggtcagacggtcaagatgacccggatgcgc
aaggtcatcggcgagaacatgatgaaggccctgcactcgcaggcccagctgaccacggtc
ctcgaggtcgacatcaccaagctgatgaagctgcgcaaccaggccaaggccgcgttcgcc
gcccgtgagggcgtcaagctgtccccgatgccgttcttcgtgaaggcggcggcccaggcg
ctgaaggcccacccggtcgtcaacgcccggatcaacgaggacgagggcaccatcacgtac
ttcgactcggagaacatcggcatcgccgtggacgccgagaagggtctgatgaccccggtc
atcaagggtgcgggcgacctgaacatcgccggtatcgccaagaagaccgcggagctcgcg
ggcaaggcgcgcggtggcggcctgacgccggacgacatgtccggcgccaccttcaccatc
agcaacaccggttcgcgcggcgccctgttcgacacggtcatcgtgccgccgaaccaggcc
gccatcctgggcatcggcgccacggtccgccgcccggtggtcatcgaccacccggacctc
ggcgagaccatcgcggtgcgcgacatgacgtacctctcgctctcctacgaccaccgtctg
gtggacggcgcggacgccgcccgctacctgacgtcggtcaaggcgatcctggaggcgggt
gagttcgaggtcgagctcggcctctga

DBGET integrated database retrieval system