KEGG   Streptomyces griseus: SGR_5351Help
Entry
SGR_5351          CDS       T00691                                 

Definition
pyridoxal-phosphate-dependent aminotransferase
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
sgr  Streptomyces griseus
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SGR_5351
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    SGR_5351
Enzymes [BR:sgr01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SGR_5351
Transfer RNA biogenesis [BR:sgr03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    SGR_5351
 Prokaryotic Type
    SGR_5351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(6298263..6299645)
Genome map
AA seq 460 aa AA seqDB search
MPYFDAASAAPLHPVARQALLAALDEGWADPARLYREGRRARLLLDAAREAAAEAVGCRP
DELVFTSSGTTAVHAGIAGALSGRRRVGRHLALSAVEHSSVLHSAAAHEAAGGSFTEVPV
DRTGAVDPAVYGGALRADTALACLQSANHEVGTEQPVAEVAARCADAGVPLLVDAAQSLG
WGPVQEGWSLLTASAHKWGGPAGVGLLAVRKGVRFAAQGPAGERESGRAAGFENLPAIVA
AAASLRAVRNEAAAESGRLRALVDRIRSVVAERVPDVEVVGDPVRRLPHLVTFSCLYVDG
ETLLHELDRREFSVSSGSSCTSSTLVPSHVLRAMGVLSEGNVRVSLPPGTAGADVDRFLE
VLPGVVAEVRERLGAPVPAPLSPGPAASLVVDALGRRCPVPVIELAKVIGEVAVGATVTV
LADDEAARLDIPAWCEMRGQEYVGEEPADRGSAHVVRRLS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgccctacttcgacgccgcctccgccgcccccctgcaccccgtcgcacgtcaggccctg
cttgccgcgcttgacgagggctgggccgatcccgcccgcctctaccgggaggggcggcgg
gccaggctgctcctggacgcggcccgggaggccgccgcggaggccgtcggctgccgcccc
gacgagctggtcttcacctcgtccgggacgacggcggtgcacgcgggaattgccggggct
ctttcggggcgtcggcgtgtcggccgccatctggccctgtcggcggtcgaacactcgtcg
gtgctccattcggctgcggcccacgaggcggcgggcggctcgttcaccgaggtcccggtg
gaccgcacgggggcggtggacccggcggtgtacggcggggcgctgcgggcggacaccgcg
ctggcctgcctccagtcggccaaccacgaggtgggcaccgagcaaccggtcgccgaggtc
gccgcccggtgcgcggacgccggggtgccgctgctggtggacgcggcccagtcgctgggc
tgggggccggtccaggagggctggtcgctgctgacggcgagcgcgcacaagtggggcggc
ccggccggggtggggctgctcgcggtccgcaagggggtgcggttcgccgcccagggtccg
gccggggagcgggagtcggggcgggcggcgggcttcgagaacctgccggcgatcgtggcg
gcggcggcctcgctgcgcgcggtccggaacgaggccgcggcggagtcggggcggctgcgg
gctctggtggaccggatccgcagcgtggtggccgagcgggtcccggacgtcgaggtggtg
ggcgatccggtgcggcggctgccgcacctggtcaccttctcgtgcctctacgtcgacggg
gagaccctgctgcacgagctggaccggagggagttctccgtttcgtccggttcgtcctgc
acgagcagcacgctggtccccagccatgtgctcagggcgatgggggtcctctcggagggc
aacgtccgggtgtcgctgccgccgggcacggccggggcggacgtggaccgcttcctggag
gtcctgcccggggtggtcgccgaggtccgggagcggctgggcgccccggttccggccccc
ctctcccccgggcccgccgcgtccctggtggtcgacgcgctgggccggcgctgcccggtc
ccggtgatcgagctcgcaaaggtgatcggggaggtagcggtgggcgccacggtgacggtg
ctcgccgacgacgaggcggcgcgcctggacatcccggcctggtgcgagatgcggggccag
gagtacgtgggcgaggagccggcggaccgcggctcggcccacgtggtccgccggctctcc
tga

DBGET integrated database retrieval system