KEGG   Streptomyces griseus: SGR_5377Help
Entry
SGR_5377          CDS       T00691                                 

Gene name
glkA
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sgr  Streptomyces griseus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGR_5377 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_5377 (glkA)
   00052 Galactose metabolism
    SGR_5377 (glkA)
   00500 Starch and sucrose metabolism
    SGR_5377 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    SGR_5377 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGR_5377 (glkA)
   00524 Butirosin and neomycin biosynthesis
    SGR_5377 (glkA)
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SGR_5377 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Structure
PDB: 

Jmol
Position
6326895..6327836
Genome map
AA seq 313 aa AA seqDB search
MGLTIGVDIGGTKIAAGVVDEEGRILSTFKVATPPTAEGIVDAICAAVAGASEGHDVEAV
GIGAAGYVDDKRATVLFAPNIDWRHEPLKDKVEQRVGLPVVVENDANAAAWGEYRFGAGQ
GHDDVICITLGTGLGGGIIIGNKLRRGRFGVAAEFGHIRVVPDGLLCGCGSQGCWEQYAS
GRALVRYAKQRANATPENAAVLLGLGDGSVDGIEGKHISEAARQGDPVAVDSFRELARWA
GAGLADLASLFDPSAFIVGGGVSDEGELVLDPIRKSFRRWLIGGEWRPHAQVLAAQLGGK
AGLVGAADLARQG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgggactcaccatcggcgtcgatatcggcggcacgaagatcgcggctggagtggtcgac
gaagagggccggatcctctcgacgttcaaggtggcgactccgccgacggccgaaggcatc
gtcgacgcgatctgcgcggcggtcgccggggcgagcgagggtcacgacgtggaggccgtc
ggcatcggcgccgccggttacgtcgacgacaagcgcgccaccgtcctcttcgcaccgaac
atcgactggcgccacgagccgctcaaggacaaggtcgagcagcgcgtcggcctgcccgtc
gtcgtcgagaacgacgccaacgccgcggcctggggcgaataccgcttcggggccggccag
ggccacgacgacgtcatctgcatcacgctcggcaccggcctcggcggcggcatcatcatc
ggcaacaagctgcgccgcggacgcttcggcgtggccgccgagttcggccacatccgggtc
gtcccggacggtctgctctgcggctgcggcagccagggctgctgggagcagtacgcctcc
ggccgcgcgctcgtccggtacgccaagcagcgcgccaacgccacccccgagaacgccgcc
gtcctgctcggtctcggcgacggctcggtggacggcatcgagggcaagcacatcagcgag
gccgcccgccagggcgacccggtggccgtcgactcgttccgcgagctggcccgctgggcc
ggcgccggactggcggacctcgcctcgctgttcgacccgtccgcgttcatcgtcggcggt
ggcgtgtcggacgagggcgagctcgtcctcgacccgatccgcaagtcgttccgacgctgg
ctgatcggcggcgaatggcgcccgcacgcccaggtgctcgccgcccaactcggcggcaag
gccgggctcgtgggcgcggccgacctggcccgccagggctga

DBGET integrated database retrieval system