KEGG   Streptomyces griseus: SGR_5377Help
Entry
SGR_5377          CDS       T00691                                 

Gene name
glkA
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sgr  Streptomyces griseus
Pathway
sgr00010  Glycolysis / Gluconeogenesis
sgr00052  Galactose metabolism
sgr00500  Starch and sucrose metabolism
sgr00520  Amino sugar and nucleotide sugar metabolism
sgr00521  Streptomycin biosynthesis
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01130  Biosynthesis of antibiotics
sgr01200  Carbon metabolism
Module
sgr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_5377 (glkA)
   00052 Galactose metabolism
    SGR_5377 (glkA)
   00500 Starch and sucrose metabolism
    SGR_5377 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    SGR_5377 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGR_5377 (glkA)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SGR_5377 (glkA)
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SGR_5377 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG Hydant_A_N DEDD_Tnp_IS110 FGGY_N
Motif
Other DBs
NCBI-ProteinID: BAG22206
Kitasato: SGR5377
UniProt: B1VZT1
Structure
PDB: 

Jmol
Position
6326895..6327836
Genome map
AA seq 313 aa AA seqDB search
MGLTIGVDIGGTKIAAGVVDEEGRILSTFKVATPPTAEGIVDAICAAVAGASEGHDVEAV
GIGAAGYVDDKRATVLFAPNIDWRHEPLKDKVEQRVGLPVVVENDANAAAWGEYRFGAGQ
GHDDVICITLGTGLGGGIIIGNKLRRGRFGVAAEFGHIRVVPDGLLCGCGSQGCWEQYAS
GRALVRYAKQRANATPENAAVLLGLGDGSVDGIEGKHISEAARQGDPVAVDSFRELARWA
GAGLADLASLFDPSAFIVGGGVSDEGELVLDPIRKSFRRWLIGGEWRPHAQVLAAQLGGK
AGLVGAADLARQG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgggactcaccatcggcgtcgatatcggcggcacgaagatcgcggctggagtggtcgac
gaagagggccggatcctctcgacgttcaaggtggcgactccgccgacggccgaaggcatc
gtcgacgcgatctgcgcggcggtcgccggggcgagcgagggtcacgacgtggaggccgtc
ggcatcggcgccgccggttacgtcgacgacaagcgcgccaccgtcctcttcgcaccgaac
atcgactggcgccacgagccgctcaaggacaaggtcgagcagcgcgtcggcctgcccgtc
gtcgtcgagaacgacgccaacgccgcggcctggggcgaataccgcttcggggccggccag
ggccacgacgacgtcatctgcatcacgctcggcaccggcctcggcggcggcatcatcatc
ggcaacaagctgcgccgcggacgcttcggcgtggccgccgagttcggccacatccgggtc
gtcccggacggtctgctctgcggctgcggcagccagggctgctgggagcagtacgcctcc
ggccgcgcgctcgtccggtacgccaagcagcgcgccaacgccacccccgagaacgccgcc
gtcctgctcggtctcggcgacggctcggtggacggcatcgagggcaagcacatcagcgag
gccgcccgccagggcgacccggtggccgtcgactcgttccgcgagctggcccgctgggcc
ggcgccggactggcggacctcgcctcgctgttcgacccgtccgcgttcatcgtcggcggt
ggcgtgtcggacgagggcgagctcgtcctcgacccgatccgcaagtcgttccgacgctgg
ctgatcggcggcgaatggcgcccgcacgcccaggtgctcgccgcccaactcggcggcaag
gccgggctcgtgggcgcggccgacctggcccgccagggctga

DBGET integrated database retrieval system