KEGG   Streptomyces griseus: SGR_5416Help
Entry
SGR_5416          CDS       T00691                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sgr  Streptomyces griseus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sgr00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sgr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
6368120..6369838
Genome map
AA seq 572 aa AA seqDB search
MTTITPDPGNRNENHRNQGPSLRETPHRPGTLTAVPHADQSQTSQKDAPVTYPGAPRPDR
LRPTPLGELADRLGVEAAGTGEVTGITHDSRAVRPGDVYAALPGARFHGADFAAQAAGLG
AAAVLTDPAGAERAAATGLPVLVTEDPRAVMGELAADIYGRPGIGLLQLGITGTSGKTTT
AYLVEGGLRAAGRPTGLIGTVEMRIGDERIKSERTTPEATDLQALFAVMRERGVEAVAME
VSSHALVLGRVDGCVFDVAVFNNLSPEHMEFHSGMEDYFQAKAQLFTPERSHRGVVNFDD
EYGRRLLTESGVPVTSFSAEGHPDADWHAEDVEVGPQDSTFTAVGPKGERITARAPLPGP
FNVANTLAAIVTLAVAGVDPQIAADGIAAVPGVPGRLERVDAGQPYLAVVDYAHKTDAVE
SVLRSLRKVTEGRVHIVLGCGGDRDTTKRGPMGAAAARLADTAVLTSDNPRSEDPLAILA
AMLSGAAEVPVHERGDVLVDADRASAIAAAVARAEPGDTVLVAGKGHEQGQDIHGVVRAF
DDRKVLHAAIERSLTRPGAADRAPHLENNSQG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccatcacccccgaccccgggaaccggaacgagaaccaccggaaccagggtccc
tcgcttcgcgagacgccgcaccggcccggtacgctcaccgccgtgccccacgctgatcag
tcccaaacctctcagaaggacgcgcctgtgacctacccgggagcgccccgaccggaccgg
ctccggcccacccccctcggcgagctggcagaccggctcggcgtcgaagcggccgggacc
ggtgaggtcaccggcatcacccacgactcacgggccgtgcgacccggagacgtgtacgcg
gccctgcccggcgcccgcttccacggcgccgacttcgcggcccaggccgccggactcggc
gccgcggccgtcctcaccgaccccgccggcgccgaacgcgccgcggccaccggcctgccg
gtgctggtcaccgaggacccgcgcgccgtcatgggcgagctggccgccgacatctacggg
cggcccggcatcggcctcctccagctcggcatcaccggaacctccggcaagaccaccacc
gcctacctcgtcgagggcggactgcgggccgctggacgccccaccgggctcatcggcacc
gtcgagatgcggatcggcgacgagcgcatcaagtccgagcgcaccacccccgaagccacc
gacctccaggcgctgttcgccgtcatgcgcgaacgcggcgtcgaggccgtcgcgatggag
gtctccagccacgccctggtgctcggccgggtcgacggctgcgtcttcgacgtcgccgtc
ttcaacaacctcagcccggagcacatggagttccactccggcatggaggactacttccag
gccaaggcccagctgttcacccccgaacgcagccaccgcggcgtcgtgaacttcgacgac
gagtacggccgcaggctcctgaccgagtccggcgtgccggtcaccagcttctccgccgag
ggccacccggacgccgactggcacgccgaggacgtcgaggtcggaccccaggacagcacc
ttcaccgccgtcggcccgaagggcgagcggatcaccgcccgcgccccgctgcccggcccg
ttcaacgtcgccaacaccctcgccgcgatcgtcacgctcgccgtcgccggcgtcgacccg
cagatcgccgcggacggcatcgccgccgtccccggggtccccggccgactggagcgggtg
gacgccggacagccctacctcgccgtcgtcgactacgcgcacaagaccgacgccgtcgag
tccgtcctgcgctccctgcgcaaggtcaccgagggcagggtgcacatcgtcctcggctgc
ggcggcgaccgcgacaccaccaagcgcggaccgatgggcgcggcggccgcccggctcgcc
gacaccgccgtcctgacctccgacaacccccgctccgaggaccccctcgcgatcctcgcc
gcgatgctctccggcgccgccgaagtgcccgtccacgagcgcggcgacgtgctcgtcgac
gccgaccgcgcctcggccatcgccgccgcggtcgcccgcgccgaaccgggcgacaccgtc
ctcgtcgccggcaagggccacgaacagggccaggacatccacggggtggtacgcgccttc
gacgaccgcaaggtcctgcacgcagccatcgagcggtccctgacgcgccccggcgccgcg
gatcgcgcacctcacctcgagaacaacagtcagggatga

DBGET integrated database retrieval system