KEGG   Streptomyces griseus: SGR_5469Help
Entry
SGR_5469          CDS       T00691                                 

Definition
(GenBank) putative indol-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sgr  Streptomyces griseus
Pathway
sgr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01130  Biosynthesis of antibiotics
sgr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGR_5469
Enzymes [BR:sgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SGR_5469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: BAG22298
Kitasato: SGR5469
UniProt: B1W0N8
Position
6426987..6427796
Genome map
AA seq 269 aa AA seqDB search
MSVLDEIIDGVRADLAERQARVSLDELKERAARAPQAKDGVAALRGEGVTVICEVKRSSP
SKGALAAIADPAALAADYEAGGASVISVLTEERRFGGSLADLEAVRAKVDIPILRKDFIV
TSYQLWEARAYGADLALLIVAALDQEALVSLIERAESIGLTPLVEAHDEEEAERAVDAGA
KIIGVNARNLKDLKVDRSTFERVAPEIPDHIVKVAESGVRGPHDLIAYANAGADAVLVGE
SLVTGRDPRAAVADLVAAGAHPALRHGRG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgctcgacgagatcatcgacggcgtccgcgccgacctcgcggagcggcaggcg
cgcgtcagcctcgacgagctgaaggagcgcgcggcccgcgctccccaggccaaggacgga
gtcgccgccctgcgcggcgagggcgtgaccgtcatctgcgaggtcaagcgctcgtccccc
tccaagggggcccttgccgccatcgccgacccggccgcgctcgccgcggactacgaggcc
ggcggcgcctccgtcatctcggtcctcaccgaggagcgccgcttcggcggttcgctcgcc
gacctggaggccgtccgcgccaaggtcgacatcccgatcctgcgcaaggacttcatcgtc
acctcgtaccagctgtgggaggcccgcgcctacggcgccgacctcgccctgctgatcgtc
gccgccctcgaccaggaggccctggtctccctgatcgagcgcgcggagtccatcgggctc
accccgctcgtcgaggcgcacgacgaggaggaggcggagcgcgccgtggacgccggagcc
aagatcatcggtgtcaacgcgcgcaacctgaaggacctcaaggtcgaccgctccaccttc
gagcgcgtcgcccccgagatccccgaccacatcgtcaaggtcgccgaatccggcgtccgg
ggcccgcacgacctgatcgcgtacgccaacgcgggcgccgacgccgtcctggtcggcgag
tccctggtcaccggccgcgacccgcgcgccgccgtcgccgacctcgtcgccgcgggcgcc
cacccggcgctccgccacggccgcggctga

DBGET integrated database retrieval system