KEGG   Streptomyces griseus: SGR_5471Help
Entry
SGR_5471          CDS       T00691                                 

Definition
(GenBank) putative tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sgr  Streptomyces griseus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGR_5471
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGR_5471
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGR_5471
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SGR_5471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6428166..6429452
Genome map
AA seq 428 aa AA seqDB search
MSSDFFIPDPEGLIPSAEGYFGAYGGKFIPEALVAAVDEVAVEYDKAKSDPAFAAELNEL
MVNYTGRPSALTEVPRFAEHAGGARIFLKREDLNHTGSHKINNVLGQALLTKRMGKTRVI
AETGAGQHGVATATACALFGLDCTIYMGEIDTERQALNVARMRMLGAEVVAVKSGSRTLK
DAINEAFRDWVANVDRTHYLFGTVAGPHPFPAMVRDFHRVIGVEARRQILERAGRLPDAA
VACVGGGSNAIGLFHAFIPDEGVRLVGCEPAGHGVETGEHAATLTAGEPGILHGSRSYVL
QDDEGQITEPYSISAGLDYPGIGPEHSYLKDVGRGEYRAVTDDAAMQALRLLSRTEGIIP
AIESAHALAGALDLGKELGKDGLILVNLSGRGDKDMDTAARYFGLYDADAAVEADADSDR
AEIEGDAK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgatttcttcattccggaccccgagggtctgatccccagcgccgagggctat
ttcggcgcgtacggcggcaagttcattccggaggcgctcgtcgccgccgtggacgaggtc
gccgtcgagtacgacaaggccaagtccgaccccgcgttcgccgccgagctcaacgagctg
atggtgaactacaccggccgccccagcgcgctcaccgaggtcccgcgcttcgccgagcac
gcgggcggcgcccggatcttcctcaagcgcgaggacctgaaccacaccggctcacacaag
atcaacaacgtgctgggccaggcgctcctcaccaagcgcatgggcaagacccgcgtcatc
gccgagaccggagccggccagcacggcgtcgccaccgcgaccgcctgcgccctcttcggc
ctcgactgcaccatctacatgggtgagatcgacaccgagcgccaggcgctgaacgtggcc
cggatgcggatgctcggcgccgaggtcgtcgccgtgaagtccggctcgcggacgctgaag
gacgccatcaacgaggcgttccgcgactgggtcgccaacgtggaccgcacgcactacctc
ttcggcacggtcgcgggcccgcaccccttccccgcgatggtccgcgacttccaccgcgtc
atcggcgtcgaggcccgccgccagatcctggagcgcgccggccgcctcccggacgcggcg
gtcgcctgcgtcggcggcggctccaacgccatcggcctcttccacgccttcatccccgac
gagggcgtccgcctggtcggctgcgagcccgccggacacggcgtggagaccggcgagcac
gcggccaccctgacggcaggggagccgggcatcctgcacggttcgcgctcctacgtcctc
caggacgacgagggccagatcaccgagccgtactccatctcggcgggcctggactacccg
ggcatcggccccgagcactcctacctcaaggacgtcgggcgcggcgagtaccgcgcggtc
accgacgacgcggccatgcaggccctgcgcctgctgtcccgcaccgaggggatcattccg
gccatcgagagcgcccacgccctcgccggcgccctggacctcggcaaggagctcggcaag
gacgggctgatcctcgtcaacctgtccggccgcggcgacaaggacatggacaccgccgcc
cgctacttcgggctctacgacgccgacgccgccgtcgaggcggacgccgacagcgaccgc
gccgagatcgagggggacgccaagtga

DBGET integrated database retrieval system