KEGG   Streptomyces griseus: SGR_5471Help
Entry
SGR_5471          CDS       T00691                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sgr  Streptomyces griseus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGR_5471
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGR_5471
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGR_5471
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SGR_5471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
6428166..6429452
Genome map
AA seq 428 aa AA seqDB search
MSSDFFIPDPEGLIPSAEGYFGAYGGKFIPEALVAAVDEVAVEYDKAKSDPAFAAELNEL
MVNYTGRPSALTEVPRFAEHAGGARIFLKREDLNHTGSHKINNVLGQALLTKRMGKTRVI
AETGAGQHGVATATACALFGLDCTIYMGEIDTERQALNVARMRMLGAEVVAVKSGSRTLK
DAINEAFRDWVANVDRTHYLFGTVAGPHPFPAMVRDFHRVIGVEARRQILERAGRLPDAA
VACVGGGSNAIGLFHAFIPDEGVRLVGCEPAGHGVETGEHAATLTAGEPGILHGSRSYVL
QDDEGQITEPYSISAGLDYPGIGPEHSYLKDVGRGEYRAVTDDAAMQALRLLSRTEGIIP
AIESAHALAGALDLGKELGKDGLILVNLSGRGDKDMDTAARYFGLYDADAAVEADADSDR
AEIEGDAK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgatttcttcattccggaccccgagggtctgatccccagcgccgagggctat
ttcggcgcgtacggcggcaagttcattccggaggcgctcgtcgccgccgtggacgaggtc
gccgtcgagtacgacaaggccaagtccgaccccgcgttcgccgccgagctcaacgagctg
atggtgaactacaccggccgccccagcgcgctcaccgaggtcccgcgcttcgccgagcac
gcgggcggcgcccggatcttcctcaagcgcgaggacctgaaccacaccggctcacacaag
atcaacaacgtgctgggccaggcgctcctcaccaagcgcatgggcaagacccgcgtcatc
gccgagaccggagccggccagcacggcgtcgccaccgcgaccgcctgcgccctcttcggc
ctcgactgcaccatctacatgggtgagatcgacaccgagcgccaggcgctgaacgtggcc
cggatgcggatgctcggcgccgaggtcgtcgccgtgaagtccggctcgcggacgctgaag
gacgccatcaacgaggcgttccgcgactgggtcgccaacgtggaccgcacgcactacctc
ttcggcacggtcgcgggcccgcaccccttccccgcgatggtccgcgacttccaccgcgtc
atcggcgtcgaggcccgccgccagatcctggagcgcgccggccgcctcccggacgcggcg
gtcgcctgcgtcggcggcggctccaacgccatcggcctcttccacgccttcatccccgac
gagggcgtccgcctggtcggctgcgagcccgccggacacggcgtggagaccggcgagcac
gcggccaccctgacggcaggggagccgggcatcctgcacggttcgcgctcctacgtcctc
caggacgacgagggccagatcaccgagccgtactccatctcggcgggcctggactacccg
ggcatcggccccgagcactcctacctcaaggacgtcgggcgcggcgagtaccgcgcggtc
accgacgacgcggccatgcaggccctgcgcctgctgtcccgcaccgaggggatcattccg
gccatcgagagcgcccacgccctcgccggcgccctggacctcggcaaggagctcggcaag
gacgggctgatcctcgtcaacctgtccggccgcggcgacaaggacatggacaccgccgcc
cgctacttcgggctctacgacgccgacgccgccgtcgaggcggacgccgacagcgaccgc
gccgagatcgagggggacgccaagtga

DBGET integrated database retrieval system