KEGG   Streptomyces griseus: SGR_5472Help
Entry
SGR_5472          CDS       T00691                                 

Definition
(GenBank) putative tryptophan synthase alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sgr  Streptomyces griseus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGR_5472
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGR_5472
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGR_5472
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SGR_5472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6429449..6430261
Genome map
AA seq 270 aa AA seqDB search
MSGNIELLNTTLAAAKAADRAALIAYLPAGFPTVDGGIEAVKAVIAGGADVVEIGLPHSD
PVLDGPVIQTADDIALRGGVRIADVMRTVREAYEATGVPILVMTYWNPIDRYGVERFTAE
LAEAGGAGCILPDLPVQESALWREHADKHGLATVFVVAPSSQDARLATITAAGSGFVYAA
SLMGVTGTRASVGAQAQDLVGRTRATTDLPVCVGLGVSNAAQAAEVAGFADGVIVGSAFV
KAMLDAPDEAAGLAAVRSLAGELAEGVRKR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcaacatcgagctgttgaacaccaccctggccgccgcgaaggccgcggaccgg
gcggcgctcatcgcctacctcccggcgggcttcccgaccgtcgacggcggcatcgaggcc
gtcaaggccgtcatcgcgggcggcgcggacgtcgtcgagatcgggctcccgcacagcgac
ccggtcctcgacgggccggtcatccagaccgccgacgacatcgccctgcgcggcggcgtc
cggatcgccgacgtgatgcgcacggttcgcgaggcgtacgaggcgaccggcgtcccgatc
ctggtcatgacgtactggaaccccatcgaccggtacggcgtcgagcgcttcaccgccgag
ctggccgaggccggcggggccggctgcatcctgcccgacctgccggtccaggagtccgcg
ctgtggcgcgagcacgccgacaagcacggtctcgccaccgtgttcgtcgtcgcccccagc
agccaggacgcccgcctcgccaccatcacggcggccgggagcggcttcgtctacgccgcg
tccctgatgggcgtcaccggaacccgcgcctccgtcggcgcccaggcccaggacctggtg
gggcgcacccgtgccaccaccgacctcccggtctgcgtcggcctcggcgtgtccaacgcg
gcgcaggccgccgaggtcgccgggttcgcggacggcgtgatcgtcggatcggccttcgtc
aaggccatgctggacgcccccgacgaggccgcgggtctcgccgccgtccgctccctggcg
ggcgaactggccgagggcgttcgaaagcgctga

DBGET integrated database retrieval system