KEGG   Streptomyces griseus: SGR_5507Help
Entry
SGR_5507          CDS       T00691                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sgr  Streptomyces griseus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SGR_5507
  Lipid metabolism
   00600 Sphingolipid metabolism
    SGR_5507
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SGR_5507
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SGR_5507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(6468253..6470145)
Genome map
AA seq 630 aa AA seqDB search
MTDFTVGDDCFRLDGKPVRLLSGALHYFRVHEAQWEHRLAMLAAMGLNCVETYVPWNLHE
PREGEVRDVGALGRFLDAVERAGLWAIVRPGPYICAEWENGGLPVWVTGRFGRRVRTRDA
AYRAVVERWFRELLPQVVRRQVSRGGPVVLVQAENEYGSYGSDAVYLEWLAGLLRQCGVT
VPLFTSDGPEDHMLTGGSVPGLLATANFGSGAREGFAVLRRHQPGGPLMCMEFWCGWFDH
WGAEPVRRDPEQAAGALREILECGASVNVYMAHGGTNFGGWAGANRSGPHQDESFQPTVT
SYDYDAPVDEYGRATEKFRLFREVLEAYAEGPLPALPPEPVGLAGPVRVELAEWAPLGDV
LEVLGDPETESGVPATFEELGVDRGLVRYRVAVPGPRQAYPLGASGLRDRAVVSVDGVRA
GVLTEESGTLPEPVAGPAEVELWVESLGRVNYGPRLGEPKGVTGGVLHERQYLHGVRARG
LRLDAFDDAGAVAAVPFGPVAGAAGAGDAGRTGLFRGTFTVEGTASASGASGDPGASGAS
TASGTPGVPGVDHAGVELPGWSRGFVWVNGFCLGRYWSAGPQRTLYVPGPVLRGGVNEVW
VLELEDAGEPRVELGPGAPADTDAPGVVQR
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacttcaccgtgggggacgactgcttccggctcgacgggaagcccgtgcggctg
ctgtcgggcgccctgcactacttccgggtgcacgaggcgcagtgggagcaccggctggcg
atgctcgccgcgatggggctgaactgtgtcgagacgtacgtgccgtggaatctgcacgag
ccccgggagggcgaggtccgggacgtgggggcgctcggccggttcctggacgcggtggag
cgggcggggctgtgggcgatcgtgcggccgggtccgtacatctgcgccgagtgggagaac
ggcggcctcccggtgtgggtgacgggccggttcgggcggcgggtgcggacccgggacgcg
gcgtaccgggcggtggtggagcggtggttccgggagttgctgccgcaggtggtgcggcgg
caggtgtcgcggggcggtccggtggtcctcgtgcaggcggagaacgagtacgggagttac
ggcagcgacgcggtgtatctggagtggctggcggggttgctgcggcagtgcggggtgacg
gttcccctgttcacgtcggacggtccggaggaccacatgctgaccggcggttcggtgccg
gggctgctggcgacggcgaacttcggttcgggggcgcgggaggggttcgcggtgctgcgc
cggcatcagccgggggggccgctgatgtgcatggagttctggtgcgggtggttcgaccac
tggggggccgagccggtgcgccgggatccggaacaggcggccggggcgctgcgggagatc
ctggagtgcggggcgtcggtgaacgtctacatggcgcacggggggacgaacttcgggggc
tgggcgggggcgaaccgttccggaccgcatcaggacgagtcgttccagccgacggtgacg
tcgtacgactacgacgcgccggtcgacgagtacgggcgggccacggagaagttccggctg
ttccgggaggtcctggaggcgtacgccgaggggccgttgcccgcgctgccgccggagccg
gtcgggctcgcgggtccggtgcgggtggagttggcggagtgggccccgctcggggacgtc
ctggaggtgctgggcgatccggagacggagtcgggggtgcctgcgacgttcgaggagctg
ggcgtggaccgggggctggtgcgctaccgggtggcggtgccggggccgcgccaggcgtat
ccgctgggggcgtcggggctgcgggaccgggcggtggtgtccgtggacggggtccgggcc
ggggtgctgaccgaggagtccgggacgctgccggagccggtcgcgggccctgcggaggtc
gagctgtgggtggagtcgctgggccgggtcaactacgggccgcgcctgggtgagccgaag
ggcgtcacgggcggggtgctgcacgagcggcagtatctgcacggggtacgggcccggggg
ctgcggctcgacgcgttcgacgacgcgggcgcggtggccgcggtcccgttcgggccggtg
gccggtgccgcgggggcgggcgacgcggggcggacgggtctgttccgggggacgttcacc
gtcgaggggaccgcgagcgcttcaggcgcctccggcgatcccggcgcctccggcgcatca
accgcttccggcacgcccggcgttcccggtgtcgatcacgcgggggtcgaactgccgggc
tggtcccgcgggttcgtctgggtgaacggcttctgcctgggccggtactggtcggcgggc
ccgcagcggaccctgtacgtgccgggcccggtgctccgcggcggtgtcaacgaggtgtgg
gtcctggagctggaggacgcgggcgagccgcgggtggagctgggtccgggggcgcccgcc
gatacggacgcccccggggtggttcagcgctga

DBGET integrated database retrieval system